NTDB

Overview

Name	pilA/pilAI	Type	Machinery gene
Locus tag	L9B60_RS16005	Genome accession	NZ_CP094975
Coordinates	3489791..3490186 (+)	Length	131 a.a.
NCBI ID	WP_249679751.1	Uniprot ID	-
Organism	Pseudomonas abieticivorans strain PIA16
Function	assembly of type IV pilus (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	3489791..3503240	3489791..3490186	within	0

Gene organization within MGE regions

Location: 3489791..3503240

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
L9B60_RS16005	pilA/pilAI	3489791..3490186 (+)	396	WP_249679751.1	pilin	Machinery gene
L9B60_RS16010	-	3490306..3490722 (+)	417	WP_249671622.1	pilin	-
L9B60_RS16020	-	3491051..3491269 (-)	219	WP_249671623.1	hypothetical protein	-
L9B60_RS16025	-	3491626..3491940 (+)	315	WP_249679752.1	HNH endonuclease	-
L9B60_RS16030	-	3491989..3492600 (-)	612	WP_249671624.1	recombinase family protein	-
L9B60_RS16035	-	3492798..3496247 (+)	3450	WP_249671625.1	ATP-binding protein	-
L9B60_RS16040	-	3496244..3496960 (+)	717	WP_249671626.1	hypothetical protein	-
L9B60_RS16045	-	3497160..3498296 (+)	1137	WP_249671627.1	nucleoid-associated protein	-
L9B60_RS16050	-	3498289..3499515 (+)	1227	WP_249671628.1	hypothetical protein	-
L9B60_RS16055	-	3499948..3500727 (+)	780	WP_249671629.1	hypothetical protein	-
L9B60_RS16060	-	3501012..3501263 (-)	252	WP_349631951.1	helix-turn-helix domain-containing protein	-
L9B60_RS16065	-	3501363..3501947 (+)	585	WP_249671631.1	hypothetical protein	-
L9B60_RS16070	-	3502005..3503240 (-)	1236	WP_249671632.1	site-specific integrase	-

Sequence

Protein

Download Length: 131 a.a. Molecular weight: 13181.32 Da Isoelectric Point: 8.4936

                                >NTDB_id=674662 L9B60_RS16005 WP_249679751.1 3489791..3490186(+) (pilA/pilAI) [Pseudomonas abieticivorans strain PIA16]

MKGQKGFTLIELLIVVAIIGILAAIAIPAYSKYQARAKATAGLAEISALKTGFEDALSSSVVPSTAASIGGTSPTQNCTL

TVTGTTIVCALVGAPTVISTGTITLTRDATTGWTCATNAIITADYKPKGCS

Nucleotide

Download Length: 396 bp

                                >NTDB_id=674662 L9B60_RS16005 WP_249679751.1 3489791..3490186(+) (pilA/pilAI) [Pseudomonas abieticivorans strain PIA16]

ATGAAGGGACAGAAGGGTTTTACCCTGATCGAGCTGTTGATCGTTGTAGCGATCATCGGCATTCTGGCCGCTATTGCGAT

CCCTGCATACTCCAAGTATCAGGCACGCGCTAAAGCCACCGCTGGCTTGGCAGAAATTTCGGCTCTTAAAACGGGCTTTG

AAGATGCATTGAGCAGCAGTGTTGTACCATCAACTGCGGCCAGCATTGGCGGTACTAGCCCGACTCAGAACTGCACCCTC

ACCGTAACTGGTACGACTATCGTATGTGCTCTGGTTGGGGCGCCGACTGTTATTTCGACTGGCACCATCACGTTGACCCG

AGACGCAACGACCGGTTGGACCTGTGCGACTAACGCCATTATCACCGCCGACTACAAGCCAAAGGGCTGTTCTTGA

Domains

Predicted by InterproScan.

Pilin (bacterial filament) (Pilin)

(35-130)

Prokaryotic N-terminal methylation motif (N_methyl)

(1-26)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
pilA/pilAI	Pseudomonas stutzeri DSM 10701	47.794	100	0.496
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	42.657	100	0.466
pilA	Vibrio cholerae strain A1552	42.657	100	0.466
pilA	Vibrio cholerae C6706	42.657	100	0.466
pilA	Acinetobacter baumannii strain A118	43.571	100	0.466
pilA	Pseudomonas aeruginosa PAK	39.735	100	0.458
pilA2	Legionella pneumophila strain ERS1305867	44.444	100	0.458
pilA2	Legionella pneumophila str. Paris	43.165	100	0.458
pilA/pilAII	Pseudomonas stutzeri DSM 10701	41.791	100	0.427
pilA	Vibrio parahaemolyticus RIMD 2210633	39.098	100	0.397

Detailed information NTG0674662