Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | MUA97_RS08135 | Genome accession | NZ_CP094811 |
| Coordinates | 1667836..1668255 (-) | Length | 139 a.a. |
| NCBI ID | WP_262608276.1 | Uniprot ID | - |
| Organism | Staphylococcus agnetis strain IVB6187 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1638350..1685405 | 1667836..1668255 | within | 0 |
Gene organization within MGE regions
Location: 1638350..1685405
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MUA97_RS07940 (MUA97_07925) | - | 1638350..1639819 (-) | 1470 | WP_262608240.1 | SH3 domain-containing protein | - |
| MUA97_RS07945 (MUA97_07930) | - | 1639821..1640069 (-) | 249 | WP_194747456.1 | phage holin | - |
| MUA97_RS07950 (MUA97_07935) | - | 1640209..1640553 (-) | 345 | WP_060551317.1 | hypothetical protein | - |
| MUA97_RS07955 (MUA97_07940) | - | 1640601..1640915 (-) | 315 | WP_262608242.1 | hypothetical protein | - |
| MUA97_RS07960 (MUA97_07945) | - | 1640958..1641107 (-) | 150 | WP_262608243.1 | hypothetical protein | - |
| MUA97_RS07965 (MUA97_07950) | - | 1641118..1644600 (-) | 3483 | WP_262608244.1 | phage tail spike protein | - |
| MUA97_RS07970 (MUA97_07955) | - | 1644602..1646089 (-) | 1488 | WP_262608245.1 | phage tail family protein | - |
| MUA97_RS07975 (MUA97_07960) | - | 1646086..1650891 (-) | 4806 | WP_262608246.1 | phage tail tape measure protein | - |
| MUA97_RS07980 (MUA97_07965) | gpGT | 1650908..1651051 (-) | 144 | WP_262608247.1 | phage tail assembly chaperone GT | - |
| MUA97_RS07985 (MUA97_07970) | gpG | 1651111..1651482 (-) | 372 | WP_262608248.1 | phage tail assembly chaperone G | - |
| MUA97_RS07990 (MUA97_07975) | - | 1651542..1651721 (-) | 180 | WP_262608249.1 | hypothetical protein | - |
| MUA97_RS07995 (MUA97_07980) | - | 1651742..1652365 (-) | 624 | WP_262608250.1 | major tail protein | - |
| MUA97_RS08000 (MUA97_07985) | - | 1652378..1652788 (-) | 411 | WP_262608251.1 | hypothetical protein | - |
| MUA97_RS08005 (MUA97_07990) | - | 1652794..1653183 (-) | 390 | WP_262608252.1 | hypothetical protein | - |
| MUA97_RS08010 (MUA97_07995) | - | 1653173..1653541 (-) | 369 | WP_262608254.1 | hypothetical protein | - |
| MUA97_RS08015 (MUA97_08000) | - | 1653525..1653812 (-) | 288 | WP_262608255.1 | phage gp6-like head-tail connector protein | - |
| MUA97_RS08020 (MUA97_08005) | - | 1653830..1655038 (-) | 1209 | WP_262608256.1 | phage major capsid protein | - |
| MUA97_RS08025 (MUA97_08010) | - | 1655050..1655763 (-) | 714 | WP_262608257.1 | head maturation protease, ClpP-related | - |
| MUA97_RS08030 (MUA97_08015) | - | 1655726..1656904 (-) | 1179 | WP_262608258.1 | phage portal protein | - |
| MUA97_RS08035 (MUA97_08020) | - | 1656924..1658591 (-) | 1668 | WP_262608259.1 | terminase TerL endonuclease subunit | - |
| MUA97_RS08040 (MUA97_08025) | - | 1658578..1658961 (-) | 384 | WP_107371945.1 | hypothetical protein | - |
| MUA97_RS08045 (MUA97_08030) | - | 1659108..1659422 (-) | 315 | WP_262608260.1 | HNH endonuclease | - |
| MUA97_RS08050 (MUA97_08035) | - | 1659687..1660082 (-) | 396 | WP_262608261.1 | hypothetical protein | - |
| MUA97_RS08055 (MUA97_08040) | - | 1660348..1660536 (-) | 189 | WP_262608262.1 | hypothetical protein | - |
| MUA97_RS08060 (MUA97_08045) | - | 1660799..1661098 (-) | 300 | WP_165805114.1 | MazG-like family protein | - |
| MUA97_RS08065 (MUA97_08050) | - | 1661246..1661605 (-) | 360 | WP_262608263.1 | thermonuclease family protein | - |
| MUA97_RS08070 (MUA97_08055) | - | 1661612..1661848 (-) | 237 | WP_262608264.1 | hypothetical protein | - |
| MUA97_RS08075 (MUA97_08060) | - | 1661852..1662052 (-) | 201 | WP_262608265.1 | hypothetical protein | - |
| MUA97_RS08080 (MUA97_08065) | - | 1662042..1662302 (-) | 261 | WP_262608266.1 | hypothetical protein | - |
| MUA97_RS08085 (MUA97_08070) | - | 1662299..1662685 (-) | 387 | WP_262608267.1 | hypothetical protein | - |
| MUA97_RS08090 (MUA97_08075) | dcm | 1662672..1663916 (-) | 1245 | WP_262608268.1 | DNA (cytosine-5-)-methyltransferase | - |
| MUA97_RS08095 (MUA97_08080) | - | 1663928..1664140 (-) | 213 | WP_262608269.1 | DUF3269 family protein | - |
| MUA97_RS08100 (MUA97_08085) | - | 1664140..1664331 (-) | 192 | WP_103345527.1 | hypothetical protein | - |
| MUA97_RS08105 (MUA97_08090) | - | 1664426..1664758 (-) | 333 | WP_262608270.1 | hypothetical protein | - |
| MUA97_RS08110 (MUA97_08095) | - | 1664760..1665182 (-) | 423 | WP_262608271.1 | RusA family crossover junction endodeoxyribonuclease | - |
| MUA97_RS08120 (MUA97_08105) | - | 1665346..1666131 (-) | 786 | WP_262608273.1 | ATP-binding protein | - |
| MUA97_RS08125 (MUA97_08110) | - | 1666132..1666914 (-) | 783 | WP_262608274.1 | conserved phage C-terminal domain-containing protein | - |
| MUA97_RS08130 (MUA97_08115) | - | 1667150..1667824 (-) | 675 | WP_262608275.1 | putative HNHc nuclease | - |
| MUA97_RS08135 (MUA97_08120) | ssbA | 1667836..1668255 (-) | 420 | WP_262608276.1 | single-stranded DNA-binding protein | Machinery gene |
| MUA97_RS08140 (MUA97_08125) | - | 1668248..1668892 (-) | 645 | WP_262608277.1 | ERF family protein | - |
| MUA97_RS08145 (MUA97_08130) | - | 1668879..1669445 (-) | 567 | WP_262608278.1 | NUMOD4 motif-containing HNH endonuclease | - |
| MUA97_RS08150 (MUA97_08135) | - | 1669442..1669660 (-) | 219 | WP_262608279.1 | DUF2483 domain-containing protein | - |
| MUA97_RS08155 (MUA97_08140) | - | 1669657..1669923 (-) | 267 | WP_262608280.1 | DUF1108 family protein | - |
| MUA97_RS08160 (MUA97_08145) | - | 1670178..1670504 (-) | 327 | WP_262608281.1 | DUF771 domain-containing protein | - |
| MUA97_RS08165 (MUA97_08150) | - | 1670517..1670798 (-) | 282 | WP_262608282.1 | hypothetical protein | - |
| MUA97_RS08170 (MUA97_08155) | - | 1670839..1671081 (-) | 243 | WP_262608283.1 | hypothetical protein | - |
| MUA97_RS08175 (MUA97_08160) | - | 1671099..1671434 (+) | 336 | WP_262608284.1 | hypothetical protein | - |
| MUA97_RS08180 (MUA97_08165) | - | 1671613..1671948 (+) | 336 | WP_262608285.1 | hypothetical protein | - |
| MUA97_RS08185 (MUA97_08170) | - | 1671934..1672167 (-) | 234 | WP_060551355.1 | hypothetical protein | - |
| MUA97_RS08190 (MUA97_08175) | - | 1672178..1672927 (-) | 750 | WP_262608286.1 | phage antirepressor KilAC domain-containing protein | - |
| MUA97_RS08195 (MUA97_08180) | - | 1672943..1673182 (-) | 240 | WP_107400375.1 | helix-turn-helix transcriptional regulator | - |
| MUA97_RS08200 (MUA97_08185) | - | 1673352..1674050 (+) | 699 | WP_262608287.1 | XRE family transcriptional regulator | - |
| MUA97_RS08205 (MUA97_08190) | - | 1674067..1674228 (+) | 162 | WP_158224802.1 | hypothetical protein | - |
| MUA97_RS08210 (MUA97_08195) | - | 1674271..1674750 (+) | 480 | WP_262608288.1 | hypothetical protein | - |
| MUA97_RS08215 (MUA97_08200) | - | 1675722..1676375 (+) | 654 | WP_262569499.1 | CPBP family intramembrane glutamic endopeptidase | - |
| MUA97_RS08220 (MUA97_08205) | - | 1676444..1677469 (+) | 1026 | WP_262608289.1 | site-specific integrase | - |
| MUA97_RS12170 | - | 1679459..1680013 (-) | 555 | WP_316961121.1 | MFS transporter | - |
| MUA97_RS12175 | - | 1680022..1680618 (-) | 597 | WP_316961122.1 | MFS transporter | - |
| MUA97_RS08235 (MUA97_08220) | - | 1681189..1681554 (+) | 366 | WP_262608290.1 | complement inhibitor SCIN family protein | - |
| MUA97_RS08240 (MUA97_08225) | - | 1681844..1683082 (+) | 1239 | WP_262608291.1 | aminoacyltransferase | - |
| MUA97_RS08245 (MUA97_08230) | - | 1683486..1684346 (-) | 861 | WP_107368710.1 | M23 family metallopeptidase | - |
| MUA97_RS08250 (MUA97_08235) | - | 1684481..1684795 (+) | 315 | WP_105995271.1 | hypothetical protein | - |
| MUA97_RS08255 (MUA97_08240) | - | 1684905..1685405 (-) | 501 | WP_105995272.1 | YfcE family phosphodiesterase | - |
Sequence
Protein
Download Length: 139 a.a. Molecular weight: 15717.34 Da Isoelectric Point: 5.1936
>NTDB_id=673053 MUA97_RS08135 WP_262608276.1 1667836..1668255(-) (ssbA) [Staphylococcus agnetis strain IVB6187]
MLNRVVLVGRLTKDPEFRTTPSVVDVSTFTLAVNRNFKNKDGEQQADFINCVVFRKQAENVKNFLSKGSLAGVDGRMQSR
SYENKEGQRVYVTEVVCDSVQFLDPKNHNQQNNQQQNGQTQTGNNPFDNASIDDDDLPF
MLNRVVLVGRLTKDPEFRTTPSVVDVSTFTLAVNRNFKNKDGEQQADFINCVVFRKQAENVKNFLSKGSLAGVDGRMQSR
SYENKEGQRVYVTEVVCDSVQFLDPKNHNQQNNQQQNGQTQTGNNPFDNASIDDDDLPF
Nucleotide
Download Length: 420 bp
>NTDB_id=673053 MUA97_RS08135 WP_262608276.1 1667836..1668255(-) (ssbA) [Staphylococcus agnetis strain IVB6187]
ATGCTTAACAGAGTTGTATTAGTAGGACGATTAACAAAAGACCCTGAATTCAGAACGACGCCATCAGTCGTAGACGTATC
AACATTCACACTTGCGGTAAATCGCAATTTCAAAAATAAAGATGGAGAACAACAAGCTGACTTTATTAATTGCGTTGTAT
TCCGCAAGCAAGCTGAAAACGTCAAAAACTTTCTAAGTAAAGGTAGCTTAGCAGGTGTTGATGGGCGAATGCAATCACGT
AGCTACGAAAATAAAGAAGGTCAACGTGTTTATGTAACTGAAGTCGTTTGTGACAGTGTTCAATTTCTAGACCCAAAGAA
CCACAACCAACAGAATAACCAACAACAAAACGGACAAACGCAAACAGGTAATAATCCTTTTGATAACGCTAGTATCGATG
ACGACGATTTACCTTTCTAG
ATGCTTAACAGAGTTGTATTAGTAGGACGATTAACAAAAGACCCTGAATTCAGAACGACGCCATCAGTCGTAGACGTATC
AACATTCACACTTGCGGTAAATCGCAATTTCAAAAATAAAGATGGAGAACAACAAGCTGACTTTATTAATTGCGTTGTAT
TCCGCAAGCAAGCTGAAAACGTCAAAAACTTTCTAAGTAAAGGTAGCTTAGCAGGTGTTGATGGGCGAATGCAATCACGT
AGCTACGAAAATAAAGAAGGTCAACGTGTTTATGTAACTGAAGTCGTTTGTGACAGTGTTCAATTTCTAGACCCAAAGAA
CCACAACCAACAGAATAACCAACAACAAAACGGACAAACGCAAACAGGTAATAATCCTTTTGATAACGCTAGTATCGATG
ACGACGATTTACCTTTCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.233 |
100 |
0.683 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.619 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
76.259 |
0.453 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
42.446 |
100 |
0.424 |
| ssbA | Streptococcus mutans UA159 |
40.288 |
100 |
0.403 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
36.879 |
100 |
0.374 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
36.879 |
100 |
0.374 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
36.17 |
100 |
0.367 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
36.17 |
100 |
0.367 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
36.17 |
100 |
0.367 |
| ssbB/cilA | Streptococcus mitis SK321 |
36.17 |
100 |
0.367 |