Detailed information NTG0672758

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: MUA16_RS07810
• Genome accession: NZ_CP094797
• Coordinates: 1623013..1623324 (-)
• Length: 103 a.a.
• NCBI ID: WP_000472257.1
• Uniprot ID: A0A115HMG3
• Organism: Staphylococcus aureus strain IVB6163
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1618013..1628324

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
MUA16_RS07775 (MUA16_07770)	gcvPA	1618515..1619861 (-)	1347	WP_000019697.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
MUA16_RS07780 (MUA16_07775)	gcvT	1619881..1620972 (-)	1092	WP_000093347.1	glycine cleavage system aminomethyltransferase GcvT	-
MUA16_RS07785 (MUA16_07780)	-	1621131..1621655 (-)	525	WP_001015125.1	shikimate kinase	-
MUA16_RS07790 (MUA16_07785)	-	1621645..1621791 (-)	147	WP_001789879.1	hypothetical protein	-
MUA16_RS07795 (MUA16_07790)	comGF	1621888..1622385 (-)	498	WP_001794328.1	competence type IV pilus minor pilin ComGF	Machinery gene
MUA16_RS07800 (MUA16_07795)	comGE	1622303..1622602 (-)	300	WP_000844413.1	hypothetical protein	Machinery gene
MUA16_RS07805 (MUA16_07800)	comGD	1622589..1623035 (-)	447	WP_001791207.1	competence type IV pilus minor pilin ComGD	Machinery gene
MUA16_RS07810 (MUA16_07805)	comGC	1623013..1623324 (-)	312	WP_000472257.1	competence type IV pilus major pilin ComGC	Machinery gene
MUA16_RS07815 (MUA16_07810)	comGB	1623338..1624408 (-)	1071	WP_000776412.1	competence type IV pilus assembly protein ComGB	Machinery gene
MUA16_RS07820 (MUA16_07815)	comGA	1624380..1625354 (-)	975	WP_000697220.1	competence type IV pilus ATPase ComGA	Machinery gene
MUA16_RS07825 (MUA16_07820)	-	1625406..1626029 (-)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
MUA16_RS07830 (MUA16_07825)	-	1626026..1626355 (-)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
MUA16_RS07835 (MUA16_07830)	-	1626355..1627341 (-)	987	WP_000161314.1	ROK family glucokinase	-
MUA16_RS07840 (MUA16_07835)	-	1627338..1627541 (-)	204	WP_000087561.1	YqgQ family protein	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11373.39 Da
• Isoelectric Point: 7.8600

>NTDB_id=672758 MUA16_RS07810 WP_000472257.1 1623013..1623324(-) (comGC) [Staphylococcus aureus strain IVB6163]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEEQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=672758 MUA16_RS07810 WP_000472257.1 1623013..1623324(-) (comGC) [Staphylococcus aureus strain IVB6163]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGAGCAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

3D structure

• AlphaFold DB: A0A115HMG3

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	99.029	100	0.99
comGC	Staphylococcus aureus MW2	99.029	100	0.99
comGC/cglC	Streptococcus mitis SK321	48.039	99.029	0.476
comGC/cglC	Streptococcus pneumoniae R6	47.059	99.029	0.466
comGC/cglC	Streptococcus pneumoniae D39	47.059	99.029	0.466
comGC/cglC	Streptococcus pneumoniae TIGR4	47.059	99.029	0.466
comGC/cglC	Streptococcus pneumoniae Rx1	47.059	99.029	0.466
comGC/cglC	Streptococcus mitis NCTC 12261	52.326	83.495	0.437
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comYC	Streptococcus mutans UA140	50	73.786	0.369
comYC	Streptococcus mutans UA159	50	73.786	0.369
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369