Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | MUA09_RS05945 | Genome accession | NZ_CP094789 |
| Coordinates | 1194038..1194466 (+) | Length | 142 a.a. |
| NCBI ID | WP_045178561.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain IVB6167 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1186595..1230150 | 1194038..1194466 | within | 0 |
Gene organization within MGE regions
Location: 1186595..1230150
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MUA09_RS05870 (MUA09_05855) | - | 1186595..1187980 (-) | 1386 | WP_000861313.1 | recombinase family protein | - |
| MUA09_RS05875 (MUA09_05860) | - | 1188088..1188288 (+) | 201 | WP_000143212.1 | excisionase | - |
| MUA09_RS05880 (MUA09_05865) | - | 1188225..1189130 (-) | 906 | WP_045178971.1 | hypothetical protein | - |
| MUA09_RS05885 (MUA09_05870) | - | 1189268..1189726 (-) | 459 | WP_045178970.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MUA09_RS05890 (MUA09_05875) | - | 1189748..1190062 (-) | 315 | WP_001118607.1 | helix-turn-helix transcriptional regulator | - |
| MUA09_RS05895 (MUA09_05880) | - | 1190215..1190427 (+) | 213 | WP_000132644.1 | helix-turn-helix transcriptional regulator | - |
| MUA09_RS05900 (MUA09_05885) | - | 1190504..1191268 (+) | 765 | WP_001148560.1 | phage antirepressor | - |
| MUA09_RS05905 (MUA09_05890) | - | 1191285..1191479 (+) | 195 | WP_000390105.1 | hypothetical protein | - |
| MUA09_RS05910 (MUA09_05895) | - | 1191683..1191913 (-) | 231 | WP_000395457.1 | hypothetical protein | - |
| MUA09_RS05915 (MUA09_05900) | - | 1191963..1192100 (+) | 138 | WP_000230552.1 | hypothetical protein | - |
| MUA09_RS05920 (MUA09_05905) | - | 1192093..1192263 (+) | 171 | WP_031782757.1 | DUF1270 domain-containing protein | - |
| MUA09_RS05925 (MUA09_05910) | - | 1192244..1192582 (+) | 339 | WP_252601107.1 | XRE family transcriptional regulator | - |
| MUA09_RS05930 (MUA09_05915) | - | 1192646..1192906 (+) | 261 | WP_045178961.1 | DUF1108 family protein | - |
| MUA09_RS05935 (MUA09_05920) | - | 1192921..1193400 (+) | 480 | WP_123138803.1 | siphovirus Gp157 family protein | - |
| MUA09_RS05940 (MUA09_05925) | - | 1193400..1194038 (+) | 639 | WP_001043063.1 | ERF family protein | - |
| MUA09_RS05945 (MUA09_05930) | ssbA | 1194038..1194466 (+) | 429 | WP_045178561.1 | single-stranded DNA-binding protein | Machinery gene |
| MUA09_RS05950 (MUA09_05935) | - | 1194480..1195148 (+) | 669 | WP_045178563.1 | putative HNHc nuclease | - |
| MUA09_RS05955 (MUA09_05940) | - | 1195148..1195933 (+) | 786 | WP_045178564.1 | AP2 domain-containing protein | - |
| MUA09_RS05960 (MUA09_05945) | - | 1195926..1196687 (+) | 762 | WP_045178566.1 | conserved phage C-terminal domain-containing protein | - |
| MUA09_RS05965 (MUA09_05950) | - | 1196700..1197485 (+) | 786 | WP_045178567.1 | ATP-binding protein | - |
| MUA09_RS05970 (MUA09_05955) | - | 1197482..1197640 (+) | 159 | WP_000628833.1 | hypothetical protein | - |
| MUA09_RS05975 (MUA09_05960) | - | 1197653..1197874 (+) | 222 | WP_001123679.1 | DUF3269 family protein | - |
| MUA09_RS05980 (MUA09_05965) | - | 1197885..1198289 (+) | 405 | WP_000049798.1 | DUF1064 domain-containing protein | - |
| MUA09_RS05985 (MUA09_05970) | - | 1198294..1198479 (+) | 186 | WP_045178949.1 | DUF3113 family protein | - |
| MUA09_RS05990 (MUA09_05975) | - | 1198480..1198842 (+) | 363 | WP_045178946.1 | SA1788 family PVL leukocidin-associated protein | - |
| MUA09_RS05995 (MUA09_05980) | - | 1198843..1199091 (+) | 249 | WP_045178944.1 | SAV1978 family virulence-associated passenger protein | - |
| MUA09_RS06000 (MUA09_05985) | - | 1199103..1199636 (+) | 534 | WP_045178572.1 | dUTP diphosphatase | - |
| MUA09_RS06005 (MUA09_05990) | - | 1199698..1199958 (+) | 261 | WP_045178942.1 | hypothetical protein | - |
| MUA09_RS06010 (MUA09_05995) | - | 1199975..1200181 (+) | 207 | WP_045179693.1 | DUF1381 domain-containing protein | - |
| MUA09_RS06015 (MUA09_06000) | - | 1200178..1200381 (+) | 204 | WP_045178938.1 | hypothetical protein | - |
| MUA09_RS06020 (MUA09_06005) | - | 1200374..1200610 (+) | 237 | WP_045178936.1 | hypothetical protein | - |
| MUA09_RS06025 (MUA09_06010) | rinB | 1200603..1200776 (+) | 174 | WP_000595257.1 | transcriptional activator RinB | - |
| MUA09_RS06030 (MUA09_06015) | - | 1200777..1200923 (+) | 147 | WP_000989998.1 | hypothetical protein | - |
| MUA09_RS06035 (MUA09_06020) | - | 1200938..1201357 (+) | 420 | WP_000058632.1 | transcriptional regulator | - |
| MUA09_RS06040 (MUA09_06025) | - | 1201544..1201984 (+) | 441 | WP_045178932.1 | terminase small subunit | - |
| MUA09_RS06045 (MUA09_06030) | - | 1201971..1203248 (+) | 1278 | WP_000169945.1 | PBSX family phage terminase large subunit | - |
| MUA09_RS06050 (MUA09_06035) | - | 1203259..1204398 (+) | 1140 | Protein_1187 | phage portal protein | - |
| MUA09_RS06055 (MUA09_06040) | - | 1204501..1205130 (+) | 630 | WP_052671740.1 | hypothetical protein | - |
| MUA09_RS06060 (MUA09_06045) | - | 1205360..1205776 (+) | 417 | Protein_1189 | phage portal protein | - |
| MUA09_RS06065 (MUA09_06050) | - | 1205783..1206778 (+) | 996 | WP_045178931.1 | minor capsid protein | - |
| MUA09_RS06070 (MUA09_06055) | - | 1206851..1207021 (+) | 171 | WP_045178928.1 | hypothetical protein | - |
| MUA09_RS06075 (MUA09_06060) | - | 1207156..1207770 (+) | 615 | WP_045178926.1 | DUF4355 domain-containing protein | - |
| MUA09_RS06080 (MUA09_06065) | - | 1207784..1208758 (+) | 975 | WP_045178923.1 | phage major capsid protein | - |
| MUA09_RS06085 (MUA09_06070) | - | 1208780..1209067 (+) | 288 | WP_045178921.1 | hypothetical protein | - |
| MUA09_RS06090 (MUA09_06075) | - | 1209076..1209408 (+) | 333 | WP_045178918.1 | phage head-tail connector protein | - |
| MUA09_RS06095 (MUA09_06080) | - | 1209405..1209707 (+) | 303 | WP_045178916.1 | hypothetical protein | - |
| MUA09_RS06100 (MUA09_06085) | - | 1209707..1210054 (+) | 348 | WP_045178913.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| MUA09_RS06105 (MUA09_06090) | - | 1210066..1210449 (+) | 384 | WP_000188649.1 | hypothetical protein | - |
| MUA09_RS06110 (MUA09_06095) | - | 1210468..1211049 (+) | 582 | WP_045178910.1 | phage major tail protein, TP901-1 family | - |
| MUA09_RS06115 (MUA09_06100) | - | 1211111..1211476 (+) | 366 | WP_001100161.1 | tail assembly chaperone | - |
| MUA09_RS06120 (MUA09_06105) | - | 1211506..1211850 (+) | 345 | WP_000105584.1 | hypothetical protein | - |
| MUA09_RS06125 (MUA09_06110) | - | 1211867..1215334 (+) | 3468 | WP_045178906.1 | membrane protein | - |
| MUA09_RS06130 (MUA09_06115) | - | 1215347..1216294 (+) | 948 | WP_031792905.1 | phage tail family protein | - |
| MUA09_RS06135 (MUA09_06120) | - | 1216303..1218204 (+) | 1902 | WP_045178903.1 | SGNH/GDSL hydrolase family protein | - |
| MUA09_RS06140 (MUA09_06125) | - | 1218219..1220129 (+) | 1911 | WP_045178895.1 | hypothetical protein | - |
| MUA09_RS06145 (MUA09_06130) | - | 1220129..1221952 (+) | 1824 | WP_045178892.1 | phage baseplate upper protein | - |
| MUA09_RS06150 (MUA09_06135) | - | 1221952..1222329 (+) | 378 | WP_045178890.1 | DUF2977 domain-containing protein | - |
| MUA09_RS06155 (MUA09_06140) | - | 1222333..1222506 (+) | 174 | WP_001800921.1 | XkdX family protein | - |
| MUA09_RS06160 (MUA09_06145) | - | 1222547..1222846 (+) | 300 | WP_045178887.1 | DUF2951 domain-containing protein | - |
| MUA09_RS06165 (MUA09_06150) | - | 1222983..1223344 (+) | 362 | Protein_1210 | CHAP domain-containing protein | - |
| MUA09_RS06170 (MUA09_06155) | - | 1223386..1223742 (+) | 357 | WP_052671739.1 | hypothetical protein | - |
| MUA09_RS06175 (MUA09_06160) | - | 1223808..1224002 (+) | 195 | WP_252592169.1 | hypothetical protein | - |
| MUA09_RS06180 (MUA09_06165) | - | 1224265..1225821 (+) | 1557 | Protein_1213 | N-acetylglucosaminidase | - |
| MUA09_RS06185 (MUA09_06170) | - | 1225834..1227072 (+) | 1239 | WP_045178883.1 | BppU family phage baseplate upper protein | - |
| MUA09_RS06190 (MUA09_06175) | - | 1227077..1227472 (+) | 396 | WP_045178881.1 | hypothetical protein | - |
| MUA09_RS06195 (MUA09_06180) | - | 1227517..1227954 (+) | 438 | WP_045178878.1 | phage holin | - |
| MUA09_RS06200 (MUA09_06185) | - | 1227935..1229380 (+) | 1446 | WP_045178875.1 | SH3 domain-containing protein | - |
| MUA09_RS06205 (MUA09_06190) | - | 1229630..1229782 (+) | 153 | WP_078103528.1 | hypothetical protein | - |
| MUA09_RS06210 (MUA09_06195) | - | 1229853..1229963 (+) | 111 | WP_031922866.1 | hypothetical protein | - |
| MUA09_RS06215 (MUA09_06200) | - | 1229965..1230150 (+) | 186 | WP_001286804.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 15966.45 Da Isoelectric Point: 5.1632
>NTDB_id=672582 MUA09_RS05945 WP_045178561.1 1194038..1194466(+) (ssbA) [Staphylococcus aureus strain IVB6167]
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKDGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQGQTQTGNNPFDNTTTITDDDLPF
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKDGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQGQTQTGNNPFDNTTTITDDDLPF
Nucleotide
Download Length: 429 bp
>NTDB_id=672582 MUA09_RS05945 WP_045178561.1 1194038..1194466(+) (ssbA) [Staphylococcus aureus strain IVB6167]
ATGTTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCGAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTGTTTGTTACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAGGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTA
CGATTACTGATGATGACTTACCGTTCTGA
ATGTTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCGAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTGTTTGTTACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAGGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTA
CGATTACTGATGATGACTTACCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
59.538 |
100 |
0.725 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.765 |
100 |
0.62 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
74.648 |
0.437 |
| ssbA | Streptococcus mutans UA159 |
41.549 |
100 |
0.415 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40.845 |
100 |
0.408 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
40.845 |
100 |
0.408 |
| ssbB/cilA | Streptococcus mitis SK321 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
40.141 |
100 |
0.401 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
47.826 |
80.986 |
0.387 |