Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | MUA79_RS08370 | Genome accession | NZ_CP094785 |
| Coordinates | 1688546..1688974 (-) | Length | 142 a.a. |
| NCBI ID | WP_045178958.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain IVB6169 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1653657..1711998 | 1688546..1688974 | within | 0 |
Gene organization within MGE regions
Location: 1653657..1711998
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MUA79_RS08125 (MUA79_08110) | - | 1653657..1654565 (-) | 909 | WP_045178743.1 | DUF1672 domain-containing protein | - |
| MUA79_RS08130 (MUA79_08115) | - | 1654655..1654840 (-) | 186 | WP_398572512.1 | hypothetical protein | - |
| MUA79_RS08135 (MUA79_08120) | sak | 1655692..1656183 (-) | 492 | WP_045178740.1 | staphylokinase | - |
| MUA79_RS08140 (MUA79_08125) | - | 1656373..1657128 (-) | 756 | WP_045178739.1 | CHAP domain-containing protein | - |
| MUA79_RS08145 (MUA79_08130) | - | 1657140..1657394 (-) | 255 | WP_045178738.1 | phage holin | - |
| MUA79_RS08150 (MUA79_08135) | - | 1657446..1657549 (+) | 104 | Protein_1605 | hypothetical protein | - |
| MUA79_RS08155 (MUA79_08140) | pepG1 | 1657598..1657732 (-) | 135 | WP_000226107.1 | type I toxin-antitoxin system toxin PepG1 | - |
| MUA79_RS08160 (MUA79_08145) | - | 1657975..1658700 (-) | 726 | Protein_1607 | exotoxin OB-fold domain-containing protein | - |
| MUA79_RS08165 (MUA79_08150) | - | 1658719..1660365 (-) | 1647 | WP_000277741.1 | IS1182-like element ISSau3 family transposase | - |
| MUA79_RS08170 (MUA79_08155) | - | 1661125..1661532 (-) | 408 | WP_000343513.1 | hypothetical protein | - |
| MUA79_RS08175 (MUA79_08160) | - | 1661588..1661875 (-) | 288 | WP_001040260.1 | hypothetical protein | - |
| MUA79_RS08180 (MUA79_08165) | - | 1661922..1662074 (-) | 153 | WP_001153680.1 | hypothetical protein | - |
| MUA79_RS08185 (MUA79_08170) | - | 1662064..1665849 (-) | 3786 | WP_045178584.1 | phage tail spike protein | - |
| MUA79_RS08190 (MUA79_08175) | - | 1665865..1667355 (-) | 1491 | WP_043039559.1 | phage distal tail protein | - |
| MUA79_RS08195 (MUA79_08180) | - | 1667355..1672004 (-) | 4650 | WP_045178581.1 | phage tail tape measure protein | - |
| MUA79_RS08200 (MUA79_08185) | gpGT | 1672061..1672183 (-) | 123 | WP_000571956.1 | phage tail assembly chaperone GT | - |
| MUA79_RS08205 (MUA79_08190) | gpG | 1672243..1672689 (-) | 447 | WP_000442601.1 | phage tail assembly chaperone G | - |
| MUA79_RS08210 (MUA79_08195) | - | 1672754..1673707 (-) | 954 | WP_000570651.1 | major tail protein | - |
| MUA79_RS08215 (MUA79_08200) | - | 1673708..1674088 (-) | 381 | WP_000611451.1 | hypothetical protein | - |
| MUA79_RS08220 (MUA79_08205) | - | 1674085..1674462 (-) | 378 | WP_000501244.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| MUA79_RS08225 (MUA79_08210) | - | 1674462..1674797 (-) | 336 | WP_000975314.1 | head-tail adaptor protein | - |
| MUA79_RS08230 (MUA79_08215) | - | 1674784..1675116 (-) | 333 | WP_001177483.1 | head-tail connector protein | - |
| MUA79_RS08235 (MUA79_08220) | - | 1675125..1675283 (-) | 159 | WP_001252099.1 | hypothetical protein | - |
| MUA79_RS08240 (MUA79_08225) | - | 1675319..1676566 (-) | 1248 | WP_000849950.1 | phage major capsid protein | - |
| MUA79_RS08245 (MUA79_08230) | - | 1676654..1677238 (-) | 585 | WP_000032525.1 | HK97 family phage prohead protease | - |
| MUA79_RS08250 (MUA79_08235) | - | 1677231..1678481 (-) | 1251 | WP_045178579.1 | phage portal protein | - |
| MUA79_RS08255 (MUA79_08240) | - | 1678487..1678726 (-) | 240 | WP_000644965.1 | membrane protein | - |
| MUA79_RS08260 (MUA79_08245) | - | 1678701..1680395 (-) | 1695 | WP_000133304.1 | terminase large subunit | - |
| MUA79_RS08265 (MUA79_08250) | - | 1680398..1680865 (-) | 468 | WP_000919026.1 | phage terminase small subunit P27 family | - |
| MUA79_RS08270 (MUA79_08255) | - | 1680993..1681337 (-) | 345 | WP_000817289.1 | HNH endonuclease | - |
| MUA79_RS08275 (MUA79_08260) | - | 1681353..1681805 (-) | 453 | WP_000406191.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| MUA79_RS08280 (MUA79_08265) | - | 1681920..1682390 (-) | 471 | WP_045178578.1 | hypothetical protein | - |
| MUA79_RS08285 (MUA79_08270) | - | 1682413..1682613 (-) | 201 | WP_045178577.1 | DUF1514 family protein | - |
| MUA79_RS08290 (MUA79_08275) | rinB | 1682613..1682762 (-) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| MUA79_RS08295 (MUA79_08280) | - | 1682759..1682965 (-) | 207 | WP_045178575.1 | DUF1381 domain-containing protein | - |
| MUA79_RS08300 (MUA79_08285) | - | 1682962..1683207 (-) | 246 | WP_045178573.1 | hypothetical protein | - |
| MUA79_RS08305 (MUA79_08290) | - | 1683224..1683397 (-) | 174 | WP_001209216.1 | hypothetical protein | - |
| MUA79_RS08310 (MUA79_08295) | - | 1683434..1683967 (-) | 534 | WP_045178572.1 | dUTP diphosphatase | - |
| MUA79_RS08315 (MUA79_08300) | - | 1683960..1684208 (-) | 249 | WP_031795415.1 | DUF1024 family protein | - |
| MUA79_RS08320 (MUA79_08305) | - | 1684222..1684470 (-) | 249 | WP_078103524.1 | SAV1978 family virulence-associated passenger protein | - |
| MUA79_RS08325 (MUA79_08310) | - | 1684470..1684724 (-) | 255 | WP_001666953.1 | DUF3310 domain-containing protein | - |
| MUA79_RS08330 (MUA79_08315) | - | 1684724..1685341 (-) | 618 | WP_045178569.1 | SA1788 family PVL leukocidin-associated protein | - |
| MUA79_RS08335 (MUA79_08320) | - | 1685342..1685527 (-) | 186 | WP_045178568.1 | DUF3113 family protein | - |
| MUA79_RS08340 (MUA79_08325) | - | 1685532..1685936 (-) | 405 | WP_000049798.1 | DUF1064 domain-containing protein | - |
| MUA79_RS08345 (MUA79_08330) | - | 1685947..1686168 (-) | 222 | WP_001123673.1 | DUF3269 family protein | - |
| MUA79_RS08350 (MUA79_08335) | - | 1686181..1686339 (-) | 159 | WP_000628833.1 | hypothetical protein | - |
| MUA79_RS08355 (MUA79_08340) | - | 1686336..1687121 (-) | 786 | WP_031900157.1 | ATP-binding protein | - |
| MUA79_RS08360 (MUA79_08345) | - | 1687134..1687865 (-) | 732 | WP_045178953.1 | helix-turn-helix domain-containing protein | - |
| MUA79_RS08365 (MUA79_08350) | - | 1687858..1688532 (-) | 675 | WP_045178956.1 | putative HNHc nuclease | - |
| MUA79_RS08370 (MUA79_08355) | ssbA | 1688546..1688974 (-) | 429 | WP_045178958.1 | single-stranded DNA-binding protein | Machinery gene |
| MUA79_RS08375 (MUA79_08360) | - | 1688974..1689612 (-) | 639 | WP_001043063.1 | ERF family protein | - |
| MUA79_RS08380 (MUA79_08365) | - | 1689612..1690091 (-) | 480 | WP_045178559.1 | siphovirus Gp157 family protein | - |
| MUA79_RS08385 (MUA79_08370) | - | 1690105..1690365 (-) | 261 | WP_000291093.1 | DUF1108 family protein | - |
| MUA79_RS08390 (MUA79_08375) | - | 1690513..1690776 (-) | 264 | WP_246864366.1 | hypothetical protein | - |
| MUA79_RS08395 (MUA79_08380) | - | 1690777..1690944 (-) | 168 | WP_045178556.1 | DUF1270 domain-containing protein | - |
| MUA79_RS08400 (MUA79_08385) | - | 1690928..1691065 (-) | 138 | WP_001568566.1 | hypothetical protein | - |
| MUA79_RS08405 (MUA79_08390) | - | 1691124..1691336 (+) | 213 | WP_000461464.1 | hypothetical protein | - |
| MUA79_RS08410 (MUA79_08395) | - | 1691351..1691428 (-) | 78 | Protein_1657 | hypothetical protein | - |
| MUA79_RS08415 (MUA79_08400) | - | 1691441..1691704 (-) | 264 | WP_031880120.1 | helix-turn-helix domain-containing protein | - |
| MUA79_RS08420 (MUA79_08405) | - | 1691853..1691952 (-) | 100 | Protein_1659 | hypothetical protein | - |
| MUA79_RS08425 (MUA79_08410) | - | 1691949..1692275 (-) | 327 | WP_001025595.1 | hypothetical protein | - |
| MUA79_RS08430 (MUA79_08415) | - | 1692602..1692841 (-) | 240 | WP_001294156.1 | hypothetical protein | - |
| MUA79_RS08435 (MUA79_08420) | - | 1692901..1693128 (+) | 228 | WP_000801108.1 | hypothetical protein | - |
| MUA79_RS08440 (MUA79_08425) | - | 1693130..1693321 (-) | 192 | WP_000389906.1 | hypothetical protein | - |
| MUA79_RS08445 (MUA79_08430) | - | 1693378..1693587 (+) | 210 | WP_000772137.1 | hypothetical protein | - |
| MUA79_RS08450 (MUA79_08435) | - | 1693580..1693720 (-) | 141 | WP_000939495.1 | hypothetical protein | - |
| MUA79_RS08455 (MUA79_08440) | - | 1693736..1694488 (-) | 753 | WP_262543753.1 | phage antirepressor KilAC domain-containing protein | - |
| MUA79_RS08460 (MUA79_08445) | - | 1694545..1694775 (+) | 231 | WP_045179168.1 | hypothetical protein | - |
| MUA79_RS08465 (MUA79_08450) | - | 1694772..1694948 (-) | 177 | WP_001001356.1 | hypothetical protein | - |
| MUA79_RS08470 (MUA79_08455) | - | 1694964..1695212 (-) | 249 | WP_000272859.1 | helix-turn-helix domain-containing protein | - |
| MUA79_RS08475 (MUA79_08460) | - | 1695376..1695699 (+) | 324 | WP_045179171.1 | helix-turn-helix domain-containing protein | - |
| MUA79_RS08480 (MUA79_08465) | - | 1695712..1696173 (+) | 462 | WP_045179173.1 | toxin | - |
| MUA79_RS08485 (MUA79_08470) | - | 1696190..1696622 (+) | 433 | Protein_1672 | hypothetical protein | - |
| MUA79_RS08490 (MUA79_08475) | - | 1696651..1697046 (+) | 396 | WP_001558060.1 | hypothetical protein | - |
| MUA79_RS08495 (MUA79_08480) | - | 1697135..1697281 (+) | 147 | WP_001795334.1 | hypothetical protein | - |
| MUA79_RS08500 (MUA79_08485) | - | 1697278..1697892 (-) | 615 | WP_000191466.1 | hypothetical protein | - |
| MUA79_RS08505 (MUA79_08490) | - | 1698018..1699223 (+) | 1206 | WP_045179176.1 | tyrosine-type recombinase/integrase | - |
| MUA79_RS08510 (MUA79_08495) | - | 1699266..1701308 (-) | 2043 | WP_001794062.1 | hypothetical protein | - |
| MUA79_RS08515 (MUA79_08500) | - | 1701295..1702227 (-) | 933 | WP_001574168.1 | DUF1672 domain-containing protein | - |
| MUA79_RS08520 (MUA79_08505) | srrB | 1702479..1704230 (-) | 1752 | WP_000987777.1 | two-component system sensor histidine kinase SrrB | - |
| MUA79_RS08525 (MUA79_08510) | srrA | 1704211..1704936 (-) | 726 | WP_000064078.1 | two-component system response regulator SrrA | - |
| MUA79_RS08530 (MUA79_08515) | - | 1705069..1705806 (-) | 738 | WP_000159577.1 | pseudouridine synthase | - |
| MUA79_RS08535 (MUA79_08520) | scpB | 1705799..1706341 (-) | 543 | WP_000368652.1 | SMC-Scp complex subunit ScpB | - |
| MUA79_RS08540 (MUA79_08525) | - | 1706334..1707065 (-) | 732 | WP_000273366.1 | segregation and condensation protein A | - |
| MUA79_RS08545 (MUA79_08530) | - | 1707157..1707663 (+) | 507 | WP_001183424.1 | DUF309 domain-containing protein | - |
| MUA79_RS08550 (MUA79_08535) | xerD | 1707741..1708628 (-) | 888 | WP_000447733.1 | site-specific tyrosine recombinase XerD | - |
| MUA79_RS08555 (MUA79_08540) | - | 1708677..1709126 (-) | 450 | WP_000392691.1 | Fur family transcriptional regulator | - |
| MUA79_RS08560 (MUA79_08545) | - | 1709231..1709773 (-) | 543 | WP_000365236.1 | NUDIX hydrolase | - |
| MUA79_RS08565 (MUA79_08550) | - | 1709855..1710763 (+) | 909 | WP_001171333.1 | aldo/keto reductase | - |
| MUA79_RS08570 (MUA79_08555) | - | 1710979..1711227 (-) | 249 | WP_000995806.1 | hypothetical protein | - |
| MUA79_RS08575 (MUA79_08560) | - | 1711243..1711998 (-) | 756 | WP_000678227.1 | SDR family NAD(P)-dependent oxidoreductase | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 16020.59 Da Isoelectric Point: 5.8724
>NTDB_id=672502 MUA79_RS08370 WP_045178958.1 1688546..1688974(-) (ssbA) [Staphylococcus aureus strain IVB6169]
MLNRTVLVGRLTKDPEYRTTPDGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
MLNRTVLVGRLTKDPEYRTTPDGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
Nucleotide
Download Length: 429 bp
>NTDB_id=672502 MUA79_RS08370 WP_045178958.1 1688546..1688974(-) (ssbA) [Staphylococcus aureus strain IVB6169]
ATGCTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCGGATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
ATGCTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCGGATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
58.14 |
100 |
0.704 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.613 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
74.648 |
0.437 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
41.958 |
100 |
0.423 |
| ssbA | Streptococcus mutans UA159 |
40.845 |
100 |
0.408 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus mitis SK321 |
39.437 |
100 |
0.394 |