Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | MUA33_RS05290 | Genome accession | NZ_CP094736 |
| Coordinates | 1065227..1065646 (+) | Length | 139 a.a. |
| NCBI ID | WP_262631238.1 | Uniprot ID | - |
| Organism | Staphylococcus delphini strain IVB6222 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1051010..1102019 | 1065227..1065646 | within | 0 |
Gene organization within MGE regions
Location: 1051010..1102019
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MUA33_RS05130 (MUA33_05120) | - | 1051010..1051561 (+) | 552 | WP_262631222.1 | alpha/beta hydrolase | - |
| MUA33_RS05180 (MUA33_05170) | - | 1052897..1053943 (-) | 1047 | WP_262631224.1 | site-specific integrase | - |
| MUA33_RS05185 (MUA33_05175) | - | 1054007..1054783 (-) | 777 | WP_262631225.1 | DUF1828 domain-containing protein | - |
| MUA33_RS12800 | - | 1054805..1055254 (-) | 450 | WP_394356325.1 | DUF6978 family protein | - |
| MUA33_RS05195 (MUA33_05185) | - | 1055620..1056657 (-) | 1038 | WP_262631226.1 | Abi family protein | - |
| MUA33_RS05200 | - | 1056975..1057157 (-) | 183 | WP_262616053.1 | hypothetical protein | - |
| MUA33_RS05205 (MUA33_05190) | - | 1057316..1057915 (+) | 600 | WP_096560178.1 | hypothetical protein | - |
| MUA33_RS05210 (MUA33_05195) | - | 1058130..1058672 (-) | 543 | WP_262631227.1 | Ltp family lipoprotein | - |
| MUA33_RS05215 (MUA33_05200) | - | 1058730..1059182 (-) | 453 | WP_262631228.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MUA33_RS05220 (MUA33_05205) | - | 1059206..1059535 (-) | 330 | WP_262613482.1 | helix-turn-helix domain-containing protein | - |
| MUA33_RS05225 (MUA33_05210) | - | 1059701..1059910 (+) | 210 | WP_015978217.1 | helix-turn-helix transcriptional regulator | - |
| MUA33_RS05230 (MUA33_05215) | - | 1059949..1060701 (+) | 753 | WP_262631229.1 | phage antirepressor KilAC domain-containing protein | - |
| MUA33_RS05235 (MUA33_05220) | - | 1060713..1060979 (+) | 267 | WP_262613484.1 | DUF2829 domain-containing protein | - |
| MUA33_RS05240 (MUA33_05225) | - | 1060969..1061280 (-) | 312 | WP_262612036.1 | hypothetical protein | - |
| MUA33_RS05245 (MUA33_05230) | - | 1061342..1062100 (+) | 759 | WP_262612037.1 | phage antirepressor | - |
| MUA33_RS05250 (MUA33_05235) | - | 1062111..1062338 (+) | 228 | WP_262612038.1 | DUF2829 domain-containing protein | - |
| MUA33_RS05255 (MUA33_05240) | - | 1062532..1062774 (-) | 243 | WP_019169771.1 | hypothetical protein | - |
| MUA33_RS05260 (MUA33_05245) | - | 1062844..1063074 (+) | 231 | WP_262631230.1 | hypothetical protein | - |
| MUA33_RS05265 (MUA33_05250) | - | 1063076..1063285 (+) | 210 | WP_262631231.1 | hypothetical protein | - |
| MUA33_RS05270 (MUA33_05255) | - | 1063555..1063815 (+) | 261 | WP_262631232.1 | DUF1108 family protein | - |
| MUA33_RS05275 (MUA33_05260) | - | 1063827..1064090 (+) | 264 | WP_262631233.1 | hypothetical protein | - |
| MUA33_RS05280 (MUA33_05265) | - | 1064074..1064559 (+) | 486 | WP_262631234.1 | siphovirus Gp157 family protein | - |
| MUA33_RS05285 (MUA33_05270) | - | 1064556..1065227 (+) | 672 | WP_262631236.1 | ERF family protein | - |
| MUA33_RS05290 (MUA33_05275) | ssbA | 1065227..1065646 (+) | 420 | WP_262631238.1 | single-stranded DNA-binding protein | Machinery gene |
| MUA33_RS05295 (MUA33_05280) | - | 1065660..1066331 (+) | 672 | WP_262631239.1 | putative HNHc nuclease | - |
| MUA33_RS05300 (MUA33_05285) | - | 1066331..1067140 (+) | 810 | WP_262631240.1 | phage replisome organizer N-terminal domain-containing protein | - |
| MUA33_RS05305 (MUA33_05290) | - | 1067137..1067478 (+) | 342 | WP_262612050.1 | hypothetical protein | - |
| MUA33_RS05310 (MUA33_05295) | - | 1067471..1068715 (+) | 1245 | WP_262631241.1 | DnaB helicase C-terminal domain-containing protein | - |
| MUA33_RS05315 (MUA33_05300) | - | 1068917..1069351 (+) | 435 | WP_262612052.1 | RusA family crossover junction endodeoxyribonuclease | - |
| MUA33_RS05320 (MUA33_05305) | - | 1069341..1069553 (+) | 213 | WP_262612053.1 | hypothetical protein | - |
| MUA33_RS05325 (MUA33_05310) | - | 1069565..1069762 (+) | 198 | WP_262612054.1 | hypothetical protein | - |
| MUA33_RS05330 (MUA33_05315) | - | 1069919..1070371 (+) | 453 | WP_262612055.1 | DUF3310 domain-containing protein | - |
| MUA33_RS05335 (MUA33_05320) | - | 1070368..1070682 (+) | 315 | WP_262612056.1 | DUF1140 family protein | - |
| MUA33_RS05340 (MUA33_05325) | - | 1070804..1071322 (+) | 519 | WP_262612057.1 | dUTP diphosphatase | - |
| MUA33_RS05345 (MUA33_05330) | - | 1071386..1071535 (+) | 150 | WP_262612058.1 | DUF1381 domain-containing protein | - |
| MUA33_RS05350 (MUA33_05335) | - | 1071535..1071828 (+) | 294 | WP_262612059.1 | hypothetical protein | - |
| MUA33_RS05355 (MUA33_05340) | - | 1071834..1071992 (+) | 159 | WP_262612060.1 | hypothetical protein | - |
| MUA33_RS05360 (MUA33_05345) | - | 1071992..1072141 (+) | 150 | WP_262612061.1 | hypothetical protein | - |
| MUA33_RS05365 (MUA33_05350) | - | 1072144..1072563 (+) | 420 | WP_262612062.1 | transcriptional regulator | - |
| MUA33_RS05370 (MUA33_05355) | - | 1072878..1073063 (+) | 186 | WP_037567940.1 | type II toxin-antitoxin system HicA family toxin | - |
| MUA33_RS05375 (MUA33_05360) | - | 1073098..1073493 (+) | 396 | WP_262612063.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| MUA33_RS05380 (MUA33_05365) | - | 1073976..1074275 (+) | 300 | WP_096666757.1 | HNH endonuclease | - |
| MUA33_RS05385 (MUA33_05370) | - | 1074411..1074794 (+) | 384 | WP_262612064.1 | hypothetical protein | - |
| MUA33_RS05390 (MUA33_05375) | - | 1074781..1076448 (+) | 1668 | WP_262631242.1 | terminase TerL endonuclease subunit | - |
| MUA33_RS05395 (MUA33_05380) | - | 1076468..1077646 (+) | 1179 | WP_262631244.1 | phage portal protein | - |
| MUA33_RS05400 (MUA33_05385) | - | 1077609..1078322 (+) | 714 | WP_262612066.1 | head maturation protease, ClpP-related | - |
| MUA33_RS05405 (MUA33_05390) | - | 1078334..1079533 (+) | 1200 | WP_262612067.1 | phage major capsid protein | - |
| MUA33_RS05410 (MUA33_05395) | - | 1079551..1079835 (+) | 285 | WP_262604845.1 | phage gp6-like head-tail connector protein | - |
| MUA33_RS05415 (MUA33_05400) | - | 1079819..1080187 (+) | 369 | WP_262604846.1 | hypothetical protein | - |
| MUA33_RS05420 (MUA33_05405) | - | 1080177..1080578 (+) | 402 | WP_262616174.1 | hypothetical protein | - |
| MUA33_RS05425 (MUA33_05410) | - | 1080584..1080994 (+) | 411 | WP_262616176.1 | hypothetical protein | - |
| MUA33_RS05430 (MUA33_05415) | - | 1081007..1081630 (+) | 624 | WP_262631245.1 | major tail protein | - |
| MUA33_RS05435 (MUA33_05420) | - | 1081648..1081827 (+) | 180 | WP_394356345.1 | hypothetical protein | - |
| MUA33_RS05440 (MUA33_05425) | gpG | 1081895..1082266 (+) | 372 | WP_096601407.1 | phage tail assembly chaperone G | - |
| MUA33_RS05445 (MUA33_05430) | gpGT | 1082326..1082469 (+) | 144 | WP_262631246.1 | phage tail assembly chaperone GT | - |
| MUA33_RS05450 (MUA33_05435) | - | 1082486..1087291 (+) | 4806 | WP_262631248.1 | phage tail tape measure protein | - |
| MUA33_RS05455 (MUA33_05440) | - | 1087288..1088772 (+) | 1485 | WP_262631249.1 | phage tail family protein | - |
| MUA33_RS05460 (MUA33_05445) | - | 1088788..1092336 (+) | 3549 | WP_262631250.1 | phage tail spike protein | - |
| MUA33_RS05465 (MUA33_05450) | - | 1092317..1092454 (+) | 138 | WP_262612072.1 | hypothetical protein | - |
| MUA33_RS05470 (MUA33_05455) | - | 1092497..1092772 (+) | 276 | WP_096586300.1 | hypothetical protein | - |
| MUA33_RS05475 (MUA33_05460) | - | 1092814..1093158 (+) | 345 | WP_262613516.1 | hypothetical protein | - |
| MUA33_RS05480 (MUA33_05465) | - | 1093292..1093540 (+) | 249 | WP_262613517.1 | SPP1 phage holin family protein | - |
| MUA33_RS05485 (MUA33_05470) | - | 1093543..1093692 (+) | 150 | WP_179295294.1 | hypothetical protein | - |
| MUA33_RS05490 (MUA33_05475) | - | 1093677..1094525 (+) | 849 | WP_262612075.1 | SH3 domain-containing protein | - |
| MUA33_RS05495 (MUA33_05480) | - | 1094911..1095543 (+) | 633 | WP_262631251.1 | Panacea domain-containing protein | - |
| MUA33_RS05500 (MUA33_05485) | - | 1095536..1095967 (+) | 432 | WP_262631252.1 | hypothetical protein | - |
| MUA33_RS05505 (MUA33_05490) | - | 1096522..1096722 (+) | 201 | WP_015728984.1 | hypothetical protein | - |
| MUA33_RS05510 (MUA33_05495) | - | 1097978..1098376 (+) | 399 | WP_155259606.1 | hypothetical protein | - |
| MUA33_RS05515 (MUA33_05500) | - | 1098679..1098894 (+) | 216 | WP_096650106.1 | hypothetical protein | - |
| MUA33_RS05520 (MUA33_05505) | - | 1100258..1101241 (-) | 984 | WP_262631253.1 | leukocidin/hemolysin toxin family protein | - |
Sequence
Protein
Download Length: 139 a.a. Molecular weight: 15673.23 Da Isoelectric Point: 4.7064
>NTDB_id=671593 MUA33_RS05290 WP_262631238.1 1065227..1065646(+) (ssbA) [Staphylococcus delphini strain IVB6222]
MLNRTILVGRLTKDPDFRTTPSGVSVATFTLAVNRTFTNAQGEREADFINCVVFRKQAENVNNFLFKGSLAGVDGRLQSR
SYENKEGQRVYVTEVVCDSVQFLEPKNNNQQNNQQQNGQTQTGNNPFDNSADFEEELPF
MLNRTILVGRLTKDPDFRTTPSGVSVATFTLAVNRTFTNAQGEREADFINCVVFRKQAENVNNFLFKGSLAGVDGRLQSR
SYENKEGQRVYVTEVVCDSVQFLEPKNNNQQNNQQQNGQTQTGNNPFDNSADFEEELPF
Nucleotide
Download Length: 420 bp
>NTDB_id=671593 MUA33_RS05290 WP_262631238.1 1065227..1065646(+) (ssbA) [Staphylococcus delphini strain IVB6222]
ATGTTAAACAGAACTATATTGGTTGGTCGATTAACAAAAGACCCTGATTTCAGAACGACGCCGTCAGGAGTAAGTGTAGC
AACATTTACTTTAGCGGTTAATCGTACATTTACGAACGCACAAGGGGAACGCGAAGCAGACTTCATTAACTGTGTAGTTT
TTCGTAAACAAGCAGAAAATGTGAACAACTTTTTGTTCAAAGGAAGTTTAGCTGGCGTTGATGGTCGCTTACAATCACGC
AGTTACGAAAATAAAGAAGGACAACGTGTATATGTAACTGAAGTCGTTTGTGACAGTGTTCAATTCCTAGAACCAAAGAA
TAACAACCAACAGAATAACCAACAACAAAACGGACAAACACAAACAGGTAATAATCCTTTTGATAACAGTGCTGACTTTG
AAGAGGAATTACCGTTCTGA
ATGTTAAACAGAACTATATTGGTTGGTCGATTAACAAAAGACCCTGATTTCAGAACGACGCCGTCAGGAGTAAGTGTAGC
AACATTTACTTTAGCGGTTAATCGTACATTTACGAACGCACAAGGGGAACGCGAAGCAGACTTCATTAACTGTGTAGTTT
TTCGTAAACAAGCAGAAAATGTGAACAACTTTTTGTTCAAAGGAAGTTTAGCTGGCGTTGATGGTCGCTTACAATCACGC
AGTTACGAAAATAAAGAAGGACAACGTGTATATGTAACTGAAGTCGTTTGTGACAGTGTTCAATTCCTAGAACCAAAGAA
TAACAACCAACAGAATAACCAACAACAAAACGGACAAACACAAACAGGTAATAATCCTTTTGATAACAGTGCTGACTTTG
AAGAGGAATTACCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.233 |
100 |
0.683 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
57.823 |
100 |
0.612 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
61.321 |
76.259 |
0.468 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.885 |
100 |
0.439 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
42.254 |
100 |
0.432 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
42.254 |
100 |
0.432 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
41.549 |
100 |
0.424 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
41.549 |
100 |
0.424 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
41.549 |
100 |
0.424 |
| ssbB/cilA | Streptococcus mitis SK321 |
41.549 |
100 |
0.424 |
| ssbA | Streptococcus mutans UA159 |
40.845 |
100 |
0.417 |