Detailed information NTG0671537

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: MUA15_RS06265
• Genome accession: NZ_CP094733
• Coordinates: 1313648..1313965 (+)
• Length: 105 a.a.
• NCBI ID: WP_032603491.1
• Uniprot ID: -
• Organism: Staphylococcus epidermidis strain IVB6194
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1308648..1318965

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
MUA15_RS06235 (MUA15_06215)	-	1309425..1309625 (+)	201	WP_001831138.1	YqgQ family protein	-
MUA15_RS06240 (MUA15_06220)	-	1309625..1310611 (+)	987	WP_001831113.1	ROK family glucokinase	-
MUA15_RS06245 (MUA15_06225)	-	1310611..1310937 (+)	327	WP_001831234.1	MTH1187 family thiamine-binding protein	-
MUA15_RS06250 (MUA15_06230)	-	1310937..1311560 (+)	624	WP_032603490.1	MBL fold metallo-hydrolase	-
MUA15_RS06255 (MUA15_06235)	comGA	1311617..1312591 (+)	975	WP_001831109.1	competence type IV pilus ATPase ComGA	Machinery gene
MUA15_RS06260 (MUA15_06240)	comGB	1312563..1313630 (+)	1068	WP_024051203.1	competence type IV pilus assembly protein ComGB	Machinery gene
MUA15_RS06265 (MUA15_06245)	comGC	1313648..1313965 (+)	318	WP_032603491.1	competence type IV pilus major pilin ComGC	Machinery gene
MUA15_RS06270 (MUA15_06250)	comGD	1313955..1314392 (+)	438	WP_001831025.1	competence type IV pilus minor pilin ComGD	-
MUA15_RS06275 (MUA15_06255)	-	1314379..1314672 (+)	294	WP_080280724.1	hypothetical protein	-
MUA15_RS06280 (MUA15_06260)	-	1314596..1315087 (+)	492	WP_002440043.1	competence type IV pilus minor pilin ComGF	-
MUA15_RS06285 (MUA15_06265)	-	1315252..1315764 (+)	513	WP_002485736.1	shikimate kinase	-
MUA15_RS06290 (MUA15_06270)	gcvT	1315982..1317073 (+)	1092	WP_001831107.1	glycine cleavage system aminomethyltransferase GcvT	-
MUA15_RS06295 (MUA15_06275)	gcvPA	1317093..1318439 (+)	1347	WP_002456181.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11478.58 Da
• Isoelectric Point: 9.7429

>NTDB_id=671537 MUA15_RS06265 WP_032603491.1 1313648..1313965(+) (comGC) [Staphylococcus epidermidis strain IVB6194]
MKTLKLLKKTRAFTLIEMLLVLLIISLLLILIIPNIAKQTSHIQSTGCDAQVKMVNSQIEAYALKHNRTPSNIDDLVSDG
FIKEGQKTCKSGQTISIANGEAVAN

Nucleotide

• Length: 318 bp

>NTDB_id=671537 MUA15_RS06265 WP_032603491.1 1313648..1313965(+) (comGC) [Staphylococcus epidermidis strain IVB6194]
ATGAAAACATTGAAATTATTGAAAAAAACACGAGCATTTACCTTGATAGAAATGCTTTTAGTATTACTAATAATAAGTTT
ATTGTTAATACTTATAATTCCAAATATTGCAAAACAAACATCTCATATTCAGTCAACTGGATGTGATGCTCAAGTTAAAA
TGGTAAACAGTCAAATAGAAGCCTACGCTTTAAAACATAATCGCACCCCTTCTAATATTGATGATTTGGTTTCAGATGGT
TTTATAAAAGAAGGACAAAAAACATGTAAATCCGGTCAGACAATTAGTATTGCAAATGGAGAAGCAGTTGCCAATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-32)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	86.275	97.143	0.838
comGC	Staphylococcus aureus N315	86.275	97.143	0.838
comYC	Streptococcus mutans UA159	50.575	82.857	0.419
comYC	Streptococcus mutans UA140	50.575	82.857	0.419
comGC/cglC	Streptococcus mitis SK321	45.745	89.524	0.41
comGC/cglC	Streptococcus pneumoniae D39	44.681	89.524	0.4
comGC/cglC	Streptococcus pneumoniae R6	44.681	89.524	0.4
comGC/cglC	Streptococcus pneumoniae Rx1	44.681	89.524	0.4
comGC/cglC	Streptococcus pneumoniae TIGR4	44.681	89.524	0.4
comYC	Streptococcus gordonii str. Challis substr. CH1	46.512	81.905	0.381
comGC	Lactococcus lactis subsp. cremoris KW2	47.561	78.095	0.371
comGC/cglC	Streptococcus mitis NCTC 12261	50	74.286	0.371
comYC	Streptococcus suis isolate S10	48.718	74.286	0.362
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	86.667	0.362