Detailed information NTG0671399

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: MUA29_RS06280
• Genome accession: NZ_CP094726
• Coordinates: 1312227..1312544 (+)
• Length: 105 a.a.
• NCBI ID: WP_032603491.1
• Uniprot ID: -
• Organism: Staphylococcus epidermidis strain IVB6256
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1307227..1317544

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
MUA29_RS06250 (MUA29_06235)	-	1308004..1308204 (+)	201	WP_001831138.1	YqgQ family protein	-
MUA29_RS06255 (MUA29_06240)	-	1308204..1309190 (+)	987	WP_001831113.1	ROK family glucokinase	-
MUA29_RS06260 (MUA29_06245)	-	1309190..1309516 (+)	327	WP_001831234.1	MTH1187 family thiamine-binding protein	-
MUA29_RS06265 (MUA29_06250)	-	1309516..1310139 (+)	624	WP_032603490.1	MBL fold metallo-hydrolase	-
MUA29_RS06270 (MUA29_06255)	comGA	1310196..1311170 (+)	975	WP_001831109.1	competence type IV pilus ATPase ComGA	Machinery gene
MUA29_RS06275 (MUA29_06260)	comGB	1311142..1312209 (+)	1068	WP_024051203.1	competence type IV pilus assembly protein ComGB	Machinery gene
MUA29_RS06280 (MUA29_06265)	comGC	1312227..1312544 (+)	318	WP_032603491.1	competence type IV pilus major pilin ComGC	Machinery gene
MUA29_RS06285 (MUA29_06270)	comGD	1312534..1312971 (+)	438	WP_001831025.1	competence type IV pilus minor pilin ComGD	-
MUA29_RS06290 (MUA29_06275)	-	1312958..1313251 (+)	294	WP_080280724.1	hypothetical protein	-
MUA29_RS06295 (MUA29_06280)	-	1313175..1313666 (+)	492	WP_002440043.1	competence type IV pilus minor pilin ComGF	-
MUA29_RS06300 (MUA29_06285)	-	1313831..1314343 (+)	513	WP_002485736.1	shikimate kinase	-
MUA29_RS06305 (MUA29_06290)	gcvT	1314561..1315652 (+)	1092	WP_001831107.1	glycine cleavage system aminomethyltransferase GcvT	-
MUA29_RS06310 (MUA29_06295)	gcvPA	1315672..1317018 (+)	1347	WP_002456181.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11478.58 Da
• Isoelectric Point: 9.7429

>NTDB_id=671399 MUA29_RS06280 WP_032603491.1 1312227..1312544(+) (comGC) [Staphylococcus epidermidis strain IVB6256]
MKTLKLLKKTRAFTLIEMLLVLLIISLLLILIIPNIAKQTSHIQSTGCDAQVKMVNSQIEAYALKHNRTPSNIDDLVSDG
FIKEGQKTCKSGQTISIANGEAVAN

Nucleotide

• Length: 318 bp

>NTDB_id=671399 MUA29_RS06280 WP_032603491.1 1312227..1312544(+) (comGC) [Staphylococcus epidermidis strain IVB6256]
ATGAAAACATTGAAATTATTGAAAAAAACACGAGCATTTACCTTGATAGAAATGCTTTTAGTATTACTAATAATAAGTTT
ATTGTTAATACTTATAATTCCAAATATTGCAAAACAAACATCTCATATTCAGTCAACTGGATGTGATGCTCAAGTTAAAA
TGGTAAACAGTCAAATAGAAGCCTACGCTTTAAAACATAATCGCACCCCTTCTAATATTGATGATTTGGTTTCAGATGGT
TTTATAAAAGAAGGACAAAAAACATGTAAATCCGGTCAGACAATTAGTATTGCAAATGGAGAAGCAGTTGCCAATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-32)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	86.275	97.143	0.838
comGC	Staphylococcus aureus N315	86.275	97.143	0.838
comYC	Streptococcus mutans UA159	50.575	82.857	0.419
comYC	Streptococcus mutans UA140	50.575	82.857	0.419
comGC/cglC	Streptococcus mitis SK321	45.745	89.524	0.41
comGC/cglC	Streptococcus pneumoniae D39	44.681	89.524	0.4
comGC/cglC	Streptococcus pneumoniae R6	44.681	89.524	0.4
comGC/cglC	Streptococcus pneumoniae Rx1	44.681	89.524	0.4
comGC/cglC	Streptococcus pneumoniae TIGR4	44.681	89.524	0.4
comYC	Streptococcus gordonii str. Challis substr. CH1	46.512	81.905	0.381
comGC	Lactococcus lactis subsp. cremoris KW2	47.561	78.095	0.371
comGC/cglC	Streptococcus mitis NCTC 12261	50	74.286	0.371
comYC	Streptococcus suis isolate S10	48.718	74.286	0.362
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	86.667	0.362