Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | MUA65_RS07750 | Genome accession | NZ_CP094722 |
| Coordinates | 1561301..1561717 (-) | Length | 138 a.a. |
| NCBI ID | WP_262605807.1 | Uniprot ID | - |
| Organism | Staphylococcus sp. IVB6218 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1526937..1573571 | 1561301..1561717 | within | 0 |
Gene organization within MGE regions
Location: 1526937..1573571
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MUA65_RS07530 (MUA65_07515) | - | 1526937..1527758 (-) | 822 | Protein_1438 | PTS lactose transporter subunit IIBC | - |
| MUA65_RS07535 (MUA65_07520) | - | 1527798..1527998 (-) | 201 | WP_262609028.1 | hypothetical protein | - |
| MUA65_RS11105 | - | 1527991..1528107 (-) | 117 | WP_346014880.1 | hypothetical protein | - |
| MUA65_RS07540 (MUA65_07525) | - | 1528456..1528881 (-) | 426 | WP_262609029.1 | protein-export chaperone SecB | - |
| MUA65_RS07545 (MUA65_07530) | - | 1528881..1529192 (-) | 312 | WP_262609030.1 | hypothetical protein | - |
| MUA65_RS07550 (MUA65_07535) | - | 1529204..1529710 (-) | 507 | WP_262609031.1 | hypothetical protein | - |
| MUA65_RS07555 (MUA65_07540) | - | 1529910..1531379 (-) | 1470 | WP_262609032.1 | SH3 domain-containing protein | - |
| MUA65_RS07560 (MUA65_07545) | - | 1531415..1531906 (-) | 492 | WP_262609033.1 | phage holin family protein | - |
| MUA65_RS07565 (MUA65_07550) | - | 1531906..1532196 (-) | 291 | WP_262609034.1 | hypothetical protein | - |
| MUA65_RS07570 (MUA65_07555) | - | 1532239..1532406 (-) | 168 | WP_262605837.1 | hypothetical protein | - |
| MUA65_RS07575 (MUA65_07560) | - | 1532393..1537126 (-) | 4734 | WP_262609036.1 | phage tail spike protein | - |
| MUA65_RS07580 (MUA65_07565) | - | 1537142..1538650 (-) | 1509 | WP_262609037.1 | phage tail family protein | - |
| MUA65_RS07585 (MUA65_07570) | - | 1538647..1543464 (-) | 4818 | WP_262619681.1 | phage tail tape measure protein | - |
| MUA65_RS07590 (MUA65_07575) | - | 1543705..1544076 (-) | 372 | WP_096601407.1 | hypothetical protein | - |
| MUA65_RS07595 (MUA65_07580) | - | 1544144..1544329 (-) | 186 | WP_262605111.1 | hypothetical protein | - |
| MUA65_RS07600 (MUA65_07585) | - | 1544341..1544964 (-) | 624 | WP_262609039.1 | major tail protein | - |
| MUA65_RS07605 (MUA65_07590) | - | 1544977..1545387 (-) | 411 | WP_262604848.1 | hypothetical protein | - |
| MUA65_RS07610 (MUA65_07595) | - | 1545393..1545794 (-) | 402 | WP_262604847.1 | hypothetical protein | - |
| MUA65_RS07615 (MUA65_07600) | - | 1545784..1546152 (-) | 369 | WP_262604846.1 | hypothetical protein | - |
| MUA65_RS07620 (MUA65_07605) | - | 1546136..1546420 (-) | 285 | WP_262604845.1 | phage gp6-like head-tail connector protein | - |
| MUA65_RS07625 (MUA65_07610) | - | 1546438..1547637 (-) | 1200 | WP_262604844.1 | phage major capsid protein | - |
| MUA65_RS07630 (MUA65_07615) | - | 1547649..1548362 (-) | 714 | WP_262619682.1 | head maturation protease, ClpP-related | - |
| MUA65_RS07635 (MUA65_07620) | - | 1548325..1549503 (-) | 1179 | WP_262609040.1 | phage portal protein | - |
| MUA65_RS07640 (MUA65_07625) | - | 1549523..1551190 (-) | 1668 | WP_262609041.1 | terminase TerL endonuclease subunit | - |
| MUA65_RS07645 (MUA65_07630) | - | 1551177..1551557 (-) | 381 | WP_262609042.1 | hypothetical protein | - |
| MUA65_RS07650 (MUA65_07635) | - | 1551685..1551984 (-) | 300 | WP_262609576.1 | HNH endonuclease | - |
| MUA65_RS07655 (MUA65_07640) | - | 1552551..1552949 (-) | 399 | WP_262609043.1 | hypothetical protein | - |
| MUA65_RS07660 (MUA65_07645) | - | 1553163..1553390 (-) | 228 | WP_262609044.1 | hypothetical protein | - |
| MUA65_RS07665 (MUA65_07650) | - | 1553390..1553533 (-) | 144 | WP_262609045.1 | hypothetical protein | - |
| MUA65_RS07670 (MUA65_07655) | - | 1553586..1553804 (-) | 219 | WP_262609046.1 | DUF1381 domain-containing protein | - |
| MUA65_RS07675 (MUA65_07660) | - | 1553899..1554510 (-) | 612 | WP_262609047.1 | hypothetical protein | - |
| MUA65_RS07680 (MUA65_07665) | - | 1554522..1555034 (-) | 513 | WP_262609048.1 | dUTP pyrophosphatase | - |
| MUA65_RS07685 (MUA65_07670) | - | 1555027..1555200 (-) | 174 | WP_199799249.1 | hypothetical protein | - |
| MUA65_RS07690 (MUA65_07675) | - | 1555201..1555746 (-) | 546 | WP_262609049.1 | hypothetical protein | - |
| MUA65_RS07695 (MUA65_07680) | - | 1555733..1555933 (-) | 201 | WP_262619683.1 | hypothetical protein | - |
| MUA65_RS07700 (MUA65_07685) | - | 1555926..1556144 (-) | 219 | WP_262609051.1 | hypothetical protein | - |
| MUA65_RS07705 (MUA65_07690) | - | 1556134..1556541 (-) | 408 | WP_262609052.1 | DUF3310 domain-containing protein | - |
| MUA65_RS07710 (MUA65_07695) | - | 1556553..1557239 (-) | 687 | WP_262609053.1 | SA1788 family PVL leukocidin-associated protein | - |
| MUA65_RS07715 (MUA65_07700) | - | 1557241..1557549 (-) | 309 | WP_262609054.1 | VRR-NUC domain-containing protein | - |
| MUA65_RS07720 (MUA65_07705) | - | 1557515..1557754 (-) | 240 | WP_262609055.1 | hypothetical protein | - |
| MUA65_RS07725 (MUA65_07710) | - | 1557751..1558989 (-) | 1239 | WP_262619684.1 | DnaB helicase C-terminal domain-containing protein | - |
| MUA65_RS07730 (MUA65_07715) | - | 1558982..1559335 (-) | 354 | WP_262605812.1 | hypothetical protein | - |
| MUA65_RS07735 (MUA65_07720) | - | 1559307..1560062 (-) | 756 | WP_262605811.1 | conserved phage C-terminal domain-containing protein | - |
| MUA65_RS07740 (MUA65_07725) | - | 1560117..1560599 (+) | 483 | WP_262605809.1 | hypothetical protein | - |
| MUA65_RS07745 (MUA65_07730) | - | 1560615..1561289 (-) | 675 | WP_262609057.1 | putative HNHc nuclease | - |
| MUA65_RS07750 (MUA65_07735) | ssb | 1561301..1561717 (-) | 417 | WP_262605807.1 | single-stranded DNA-binding protein | Machinery gene |
| MUA65_RS07755 (MUA65_07740) | - | 1561717..1562388 (-) | 672 | WP_262609058.1 | ERF family protein | - |
| MUA65_RS07760 (MUA65_07745) | - | 1562388..1562870 (-) | 483 | WP_262605805.1 | siphovirus Gp157 family protein | - |
| MUA65_RS07765 (MUA65_07750) | - | 1562863..1563015 (-) | 153 | WP_262619685.1 | hypothetical protein | - |
| MUA65_RS07770 (MUA65_07755) | - | 1563091..1563264 (-) | 174 | WP_262619686.1 | hypothetical protein | - |
| MUA65_RS07775 (MUA65_07760) | - | 1563194..1563361 (-) | 168 | WP_262619687.1 | hypothetical protein | - |
| MUA65_RS07780 (MUA65_07765) | - | 1563504..1563743 (+) | 240 | WP_262609059.1 | hypothetical protein | - |
| MUA65_RS07785 (MUA65_07770) | - | 1563733..1563912 (-) | 180 | WP_262619688.1 | hypothetical protein | - |
| MUA65_RS07790 (MUA65_07775) | - | 1564003..1564383 (+) | 381 | WP_262609061.1 | DUF2513 domain-containing protein | - |
| MUA65_RS07795 (MUA65_07780) | - | 1564370..1564567 (-) | 198 | WP_262609062.1 | hypothetical protein | - |
| MUA65_RS07800 (MUA65_07785) | - | 1564617..1564952 (+) | 336 | WP_262619689.1 | hypothetical protein | - |
| MUA65_RS07805 (MUA65_07790) | - | 1564938..1565171 (-) | 234 | WP_262619690.1 | DUF2829 domain-containing protein | - |
| MUA65_RS07810 (MUA65_07795) | - | 1565207..1565974 (-) | 768 | WP_262619691.1 | phage antirepressor | - |
| MUA65_RS07815 (MUA65_07800) | - | 1565989..1566432 (-) | 444 | WP_262613895.1 | hypothetical protein | - |
| MUA65_RS07820 (MUA65_07805) | - | 1566448..1567203 (-) | 756 | WP_262619692.1 | phage antirepressor KilAC domain-containing protein | - |
| MUA65_RS07825 (MUA65_07810) | - | 1567219..1567455 (-) | 237 | WP_262619693.1 | helix-turn-helix transcriptional regulator | - |
| MUA65_RS07830 (MUA65_07815) | - | 1567608..1567922 (+) | 315 | WP_262619694.1 | helix-turn-helix transcriptional regulator | - |
| MUA65_RS07835 (MUA65_07820) | - | 1567935..1568390 (+) | 456 | WP_262619695.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MUA65_RS07840 (MUA65_07825) | - | 1568439..1569215 (+) | 777 | WP_262619696.1 | hypothetical protein | - |
| MUA65_RS07845 (MUA65_07830) | - | 1569398..1570051 (+) | 654 | WP_262619697.1 | CPBP family intramembrane glutamic endopeptidase | - |
| MUA65_RS07850 (MUA65_07835) | - | 1570119..1571513 (+) | 1395 | WP_262619698.1 | recombinase family protein | - |
| MUA65_RS07855 (MUA65_07840) | - | 1571527..1572402 (-) | 876 | Protein_1504 | PTS transporter subunit EIIC | - |
| MUA65_RS07860 (MUA65_07845) | lacF | 1572402..1572719 (-) | 318 | WP_262603623.1 | lactose-specific PTS transporter subunit IIA | - |
| MUA65_RS07865 (MUA65_07850) | - | 1572738..1573571 (-) | 834 | WP_262609073.1 | PRD domain-containing protein | - |
Sequence
Protein
Download Length: 138 a.a. Molecular weight: 15651.27 Da Isoelectric Point: 7.7800
>NTDB_id=671275 MUA65_RS07750 WP_262605807.1 1561301..1561717(-) (ssb) [Staphylococcus sp. IVB6218]
MINRVVLAGRLTKAPEFRTTQSGVEVATFTLAVNRNYKNKNGEQQADFINCIVFRKQAENVKNYLNKGNLAGVDGRLQSR
SYENQEGRRVYVTEVVCDSVQFLEPKNNSQSNNQPKQQGQAQNNPFDNSDDEFSDLPF
MINRVVLAGRLTKAPEFRTTQSGVEVATFTLAVNRNYKNKNGEQQADFINCIVFRKQAENVKNYLNKGNLAGVDGRLQSR
SYENQEGRRVYVTEVVCDSVQFLEPKNNSQSNNQPKQQGQAQNNPFDNSDDEFSDLPF
Nucleotide
Download Length: 417 bp
>NTDB_id=671275 MUA65_RS07750 WP_262605807.1 1561301..1561717(-) (ssb) [Staphylococcus sp. IVB6218]
ATGATTAATAGAGTCGTATTAGCAGGACGATTAACAAAAGCCCCCGAATTCAGAACAACGCAATCAGGCGTGGAGGTAGC
AACTTTTACATTGGCAGTTAACCGCAATTACAAAAATAAAAACGGAGAACAACAAGCAGATTTTATAAACTGTATTGTTT
TTCGTAAGCAAGCAGAAAATGTGAAAAACTATCTAAATAAAGGAAATCTTGCAGGTGTAGATGGCCGCTTACAATCACGC
AGTTATGAAAACCAAGAAGGCCGACGTGTTTATGTAACTGAAGTCGTTTGCGACAGCGTGCAATTTTTAGAACCTAAAAA
TAATAGCCAATCTAACAATCAACCTAAACAACAAGGACAAGCGCAGAATAATCCTTTTGATAACAGTGATGACGAGTTCT
CGGATTTACCTTTCTAG
ATGATTAATAGAGTCGTATTAGCAGGACGATTAACAAAAGCCCCCGAATTCAGAACAACGCAATCAGGCGTGGAGGTAGC
AACTTTTACATTGGCAGTTAACCGCAATTACAAAAATAAAAACGGAGAACAACAAGCAGATTTTATAAACTGTATTGTTT
TTCGTAAGCAAGCAGAAAATGTGAAAAACTATCTAAATAAAGGAAATCTTGCAGGTGTAGATGGCCGCTTACAATCACGC
AGTTATGAAAACCAAGAAGGCCGACGTGTTTATGTAACTGAAGTCGTTTGCGACAGCGTGCAATTTTTAGAACCTAAAAA
TAATAGCCAATCTAACAATCAACCTAAACAACAAGGACAAGCGCAGAATAATCCTTTTGATAACAGTGATGACGAGTTCT
CGGATTTACCTTTCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
47.977 |
100 |
0.601 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
70.093 |
77.536 |
0.543 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
57.547 |
76.812 |
0.442 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
40.426 |
100 |
0.413 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
39.716 |
100 |
0.406 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
39.716 |
100 |
0.406 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
39.007 |
100 |
0.399 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
39.007 |
100 |
0.399 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
39.007 |
100 |
0.399 |
| ssbB/cilA | Streptococcus mitis SK321 |
39.007 |
100 |
0.399 |
| ssbA | Streptococcus mutans UA159 |
38.298 |
100 |
0.391 |