Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | MUA48_RS04130 | Genome accession | NZ_CP094719 |
| Coordinates | 823682..824098 (+) | Length | 138 a.a. |
| NCBI ID | WP_262604825.1 | Uniprot ID | - |
| Organism | Staphylococcus sp. IVB6238 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 807283..854702 | 823682..824098 | within | 0 |
Gene organization within MGE regions
Location: 807283..854702
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MUA48_RS04010 (MUA48_03980) | - | 807283..807783 (+) | 501 | WP_262604803.1 | metallophosphoesterase | - |
| MUA48_RS04015 (MUA48_03985) | - | 808056..808385 (+) | 330 | WP_262604804.1 | hypothetical protein | - |
| MUA48_RS04020 (MUA48_03990) | - | 808750..809862 (+) | 1113 | WP_262604805.1 | hypothetical protein | - |
| MUA48_RS04025 (MUA48_03995) | - | 810037..810840 (+) | 804 | WP_262604806.1 | LPXTG cell wall anchor domain-containing protein | - |
| MUA48_RS04030 (MUA48_04000) | - | 811383..811490 (+) | 108 | WP_262604807.1 | putative holin-like toxin | - |
| MUA48_RS04035 (MUA48_04005) | - | 812146..813171 (-) | 1026 | WP_262604808.1 | site-specific integrase | - |
| MUA48_RS04040 (MUA48_04010) | - | 813240..813893 (-) | 654 | WP_262604809.1 | CPBP family intramembrane glutamic endopeptidase | - |
| MUA48_RS04045 (MUA48_04015) | - | 814171..815139 (-) | 969 | WP_262604810.1 | DNA cytosine methyltransferase | - |
| MUA48_RS04050 (MUA48_04020) | - | 815203..815730 (-) | 528 | WP_262604811.1 | Bsp6I family type II restriction endonuclease | - |
| MUA48_RS04055 (MUA48_04025) | - | 815912..816529 (+) | 618 | WP_262604812.1 | hypothetical protein | - |
| MUA48_RS04060 (MUA48_04030) | - | 817000..817899 (-) | 900 | WP_262604813.1 | HIRAN domain-containing protein | - |
| MUA48_RS04065 (MUA48_04035) | - | 817940..818401 (-) | 462 | WP_262604814.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MUA48_RS04070 (MUA48_04040) | - | 818414..818743 (-) | 330 | WP_262604815.1 | helix-turn-helix transcriptional regulator | - |
| MUA48_RS04075 (MUA48_04045) | - | 818935..819180 (+) | 246 | WP_096543105.1 | helix-turn-helix transcriptional regulator | - |
| MUA48_RS04080 (MUA48_04050) | - | 819195..819950 (+) | 756 | WP_262604816.1 | phage antirepressor KilAC domain-containing protein | - |
| MUA48_RS04085 (MUA48_04055) | - | 820059..820337 (-) | 279 | WP_202430073.1 | hypothetical protein | - |
| MUA48_RS04090 (MUA48_04060) | - | 820478..820744 (+) | 267 | WP_262604817.1 | hypothetical protein | - |
| MUA48_RS04095 (MUA48_04065) | - | 820767..821306 (-) | 540 | WP_262604818.1 | hypothetical protein | - |
| MUA48_RS04100 (MUA48_04070) | - | 821396..821536 (+) | 141 | WP_262604819.1 | hypothetical protein | - |
| MUA48_RS04105 (MUA48_04075) | - | 821529..821738 (-) | 210 | WP_262604820.1 | hypothetical protein | - |
| MUA48_RS04110 (MUA48_04080) | - | 821805..822128 (+) | 324 | WP_262604821.1 | DUF771 domain-containing protein | - |
| MUA48_RS04115 (MUA48_04085) | - | 822384..822527 (+) | 144 | WP_262604822.1 | hypothetical protein | - |
| MUA48_RS04120 (MUA48_04090) | - | 822529..823011 (+) | 483 | WP_262604823.1 | siphovirus Gp157 family protein | - |
| MUA48_RS04125 (MUA48_04095) | - | 823011..823682 (+) | 672 | WP_262604824.1 | ERF family protein | - |
| MUA48_RS04130 (MUA48_04100) | ssbA | 823682..824098 (+) | 417 | WP_262604825.1 | single-stranded DNA-binding protein | Machinery gene |
| MUA48_RS04135 (MUA48_04105) | - | 824110..824781 (+) | 672 | WP_262604826.1 | putative HNHc nuclease | - |
| MUA48_RS04140 (MUA48_04110) | - | 824971..825684 (+) | 714 | WP_262604827.1 | DnaD domain protein | - |
| MUA48_RS04145 (MUA48_04115) | - | 825689..826036 (+) | 348 | WP_262604828.1 | hypothetical protein | - |
| MUA48_RS04150 (MUA48_04120) | - | 826029..827267 (+) | 1239 | WP_262604829.1 | DnaB helicase C-terminal domain-containing protein | - |
| MUA48_RS04155 (MUA48_04125) | - | 827264..827482 (+) | 219 | WP_262604830.1 | hypothetical protein | - |
| MUA48_RS04160 (MUA48_04130) | - | 827469..827885 (+) | 417 | WP_262604831.1 | RusA family crossover junction endodeoxyribonuclease | - |
| MUA48_RS04165 (MUA48_04135) | - | 827982..828155 (+) | 174 | WP_262604832.1 | helix-turn-helix domain-containing protein | - |
| MUA48_RS04170 (MUA48_04140) | - | 828313..828531 (+) | 219 | WP_262604833.1 | hypothetical protein | - |
| MUA48_RS04175 (MUA48_04145) | - | 828524..828676 (+) | 153 | WP_262604834.1 | hypothetical protein | - |
| MUA48_RS04180 (MUA48_04150) | - | 828946..829368 (+) | 423 | WP_262604835.1 | hypothetical protein | - |
| MUA48_RS04185 (MUA48_04155) | - | 829381..829602 (+) | 222 | WP_262604836.1 | hypothetical protein | - |
| MUA48_RS04190 (MUA48_04160) | - | 829613..830008 (+) | 396 | WP_262604837.1 | hypothetical protein | - |
| MUA48_RS04195 (MUA48_04165) | - | 830333..830518 (+) | 186 | WP_262604838.1 | type II toxin-antitoxin system HicA family toxin | - |
| MUA48_RS04200 (MUA48_04170) | - | 830553..830948 (+) | 396 | WP_262604839.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| MUA48_RS04205 (MUA48_04175) | - | 831431..831730 (+) | 300 | WP_262605110.1 | HNH endonuclease | - |
| MUA48_RS04210 (MUA48_04180) | - | 831856..832236 (+) | 381 | WP_262604840.1 | hypothetical protein | - |
| MUA48_RS04215 (MUA48_04185) | - | 832223..833890 (+) | 1668 | WP_262604841.1 | terminase TerL endonuclease subunit | - |
| MUA48_RS04220 (MUA48_04190) | - | 833910..835088 (+) | 1179 | WP_262604842.1 | phage portal protein | - |
| MUA48_RS04225 (MUA48_04195) | - | 835045..835764 (+) | 720 | WP_262604843.1 | head maturation protease, ClpP-related | - |
| MUA48_RS04230 (MUA48_04200) | - | 835776..836975 (+) | 1200 | WP_262604844.1 | phage major capsid protein | - |
| MUA48_RS04235 (MUA48_04205) | - | 836993..837277 (+) | 285 | WP_262604845.1 | phage gp6-like head-tail connector protein | - |
| MUA48_RS04240 (MUA48_04210) | - | 837261..837629 (+) | 369 | WP_262604846.1 | hypothetical protein | - |
| MUA48_RS04245 (MUA48_04215) | - | 837619..838020 (+) | 402 | WP_262604847.1 | hypothetical protein | - |
| MUA48_RS04250 (MUA48_04220) | - | 838026..838436 (+) | 411 | WP_262604848.1 | hypothetical protein | - |
| MUA48_RS04255 (MUA48_04225) | - | 838449..839072 (+) | 624 | WP_262604849.1 | major tail protein | - |
| MUA48_RS04260 (MUA48_04230) | - | 839084..839269 (+) | 186 | WP_262605111.1 | hypothetical protein | - |
| MUA48_RS04265 (MUA48_04235) | - | 839337..839708 (+) | 372 | WP_096601407.1 | hypothetical protein | - |
| MUA48_RS04270 (MUA48_04240) | - | 839768..839911 (+) | 144 | WP_168250651.1 | hypothetical protein | - |
| MUA48_RS04275 (MUA48_04245) | - | 839928..844859 (+) | 4932 | WP_262604850.1 | phage tail tape measure protein | - |
| MUA48_RS04280 (MUA48_04250) | - | 844856..846364 (+) | 1509 | WP_262604851.1 | phage tail family protein | - |
| MUA48_RS04285 (MUA48_04255) | - | 846380..850723 (+) | 4344 | WP_262604852.1 | phage tail spike protein | - |
| MUA48_RS04290 (MUA48_04260) | - | 850710..850877 (+) | 168 | WP_262604853.1 | hypothetical protein | - |
| MUA48_RS04295 (MUA48_04265) | - | 850920..851222 (+) | 303 | WP_262604854.1 | hypothetical protein | - |
| MUA48_RS04300 (MUA48_04270) | - | 851222..851713 (+) | 492 | WP_262560584.1 | phage holin family protein | - |
| MUA48_RS04305 (MUA48_04275) | - | 851749..853218 (+) | 1470 | WP_262604855.1 | SH3 domain-containing protein | - |
| MUA48_RS04310 (MUA48_04280) | - | 853385..854047 (+) | 663 | WP_262604856.1 | hypothetical protein | - |
| MUA48_RS04315 (MUA48_04285) | - | 854061..854702 (+) | 642 | WP_262604857.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 138 a.a. Molecular weight: 15538.21 Da Isoelectric Point: 4.9431
>NTDB_id=671159 MUA48_RS04130 WP_262604825.1 823682..824098(+) (ssbA) [Staphylococcus sp. IVB6238]
MINRVVLVGRLTKDPEFRATQSGVEVATFTLAVNRNFKSKDGEQQADFINCVVFRKQAENVKNFLSKGSLAGVDGRMQSR
SYENKEGQRVYVTEVVCDSVQFLEPKNNSQSNNQPKQQGQAQDNPFENTSIDDDDLPF
MINRVVLVGRLTKDPEFRATQSGVEVATFTLAVNRNFKSKDGEQQADFINCVVFRKQAENVKNFLSKGSLAGVDGRMQSR
SYENKEGQRVYVTEVVCDSVQFLEPKNNSQSNNQPKQQGQAQDNPFENTSIDDDDLPF
Nucleotide
Download Length: 417 bp
>NTDB_id=671159 MUA48_RS04130 WP_262604825.1 823682..824098(+) (ssbA) [Staphylococcus sp. IVB6238]
ATGATTAATAGAGTCGTATTAGTAGGACGATTAACAAAAGACCCCGAATTCAGAGCAACGCAATCAGGCGTGGAAGTAGC
AACATTCACACTTGCGGTAAATCGCAATTTCAAAAGTAAAGATGGAGAACAACAGGCTGATTTTATCAATTGTGTTGTAT
TCCGCAAGCAAGCTGAAAATGTTAAAAACTTTTTAAGTAAAGGTAGCTTAGCAGGCGTTGATGGACGGATGCAATCACGC
AGTTACGAAAATAAAGAAGGTCAACGTGTTTATGTAACTGAAGTCGTTTGCGACAGCGTGCAATTTTTAGAACCTAAAAA
TAATAGCCAATCTAACAATCAACCTAAACAACAAGGACAAGCGCAGGATAATCCTTTTGAAAACACTAGTATCGATGATG
ACGATTTGCCTTTCTAG
ATGATTAATAGAGTCGTATTAGTAGGACGATTAACAAAAGACCCCGAATTCAGAGCAACGCAATCAGGCGTGGAAGTAGC
AACATTCACACTTGCGGTAAATCGCAATTTCAAAAGTAAAGATGGAGAACAACAGGCTGATTTTATCAATTGTGTTGTAT
TCCGCAAGCAAGCTGAAAATGTTAAAAACTTTTTAAGTAAAGGTAGCTTAGCAGGCGTTGATGGACGGATGCAATCACGC
AGTTACGAAAATAAAGAAGGTCAACGTGTTTATGTAACTGAAGTCGTTTGCGACAGCGTGCAATTTTTAGAACCTAAAAA
TAATAGCCAATCTAACAATCAACCTAAACAACAAGGACAAGCGCAGGATAATCCTTTTGAAAACACTAGTATCGATGATG
ACGATTTGCCTTTCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.233 |
100 |
0.688 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.623 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
76.812 |
0.457 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
42.754 |
100 |
0.428 |
| ssbA | Streptococcus mutans UA159 |
41.304 |
100 |
0.413 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
39.13 |
100 |
0.391 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
39.13 |
100 |
0.391 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
38.406 |
100 |
0.384 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
38.406 |
100 |
0.384 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
38.406 |
100 |
0.384 |
| ssbB/cilA | Streptococcus mitis SK321 |
38.406 |
100 |
0.384 |