Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | MUA88_RS03925 | Genome accession | NZ_CP094718 |
| Coordinates | 790663..791079 (+) | Length | 138 a.a. |
| NCBI ID | WP_262605807.1 | Uniprot ID | - |
| Organism | Staphylococcus sp. IVB6240 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 775546..826507 | 790663..791079 | within | 0 |
Gene organization within MGE regions
Location: 775546..826507
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MUA88_RS03815 (MUA88_03805) | - | 775546..776046 (+) | 501 | WP_262605792.1 | metallophosphoesterase | - |
| MUA88_RS03820 (MUA88_03810) | - | 776319..776648 (+) | 330 | WP_262604804.1 | hypothetical protein | - |
| MUA88_RS03825 (MUA88_03815) | - | 777013..777711 (+) | 699 | WP_262605793.1 | hypothetical protein | - |
| MUA88_RS03830 (MUA88_03820) | - | 777824..778897 (-) | 1074 | WP_262605333.1 | IS30 family transposase | - |
| MUA88_RS03835 (MUA88_03825) | - | 779086..779469 (+) | 384 | WP_262605794.1 | hypothetical protein | - |
| MUA88_RS03840 (MUA88_03830) | - | 779644..780447 (+) | 804 | WP_262604806.1 | LPXTG cell wall anchor domain-containing protein | - |
| MUA88_RS03845 (MUA88_03835) | - | 780990..781097 (+) | 108 | WP_262604807.1 | putative holin-like toxin | - |
| MUA88_RS03850 (MUA88_03840) | - | 781753..782778 (-) | 1026 | WP_262605795.1 | site-specific integrase | - |
| MUA88_RS03855 (MUA88_03845) | - | 782846..783499 (-) | 654 | WP_262604809.1 | CPBP family intramembrane glutamic endopeptidase | - |
| MUA88_RS03860 (MUA88_03850) | - | 783853..784881 (-) | 1029 | WP_262605796.1 | Abi family protein | - |
| MUA88_RS03865 (MUA88_03855) | - | 784934..785299 (-) | 366 | WP_262605797.1 | FlgT C-terminal domain-containing protein | - |
| MUA88_RS10910 | - | 785418..785579 (-) | 162 | Protein_745 | DNA-binding protein | - |
| MUA88_RS03870 (MUA88_03860) | - | 785596..786210 (-) | 615 | WP_262605798.1 | XRE family transcriptional regulator | - |
| MUA88_RS03875 (MUA88_03865) | - | 786384..786611 (+) | 228 | WP_262605799.1 | BetR domain protein | - |
| MUA88_RS03880 (MUA88_03870) | - | 786633..787418 (+) | 786 | WP_262605800.1 | phage antirepressor KilAC domain-containing protein | - |
| MUA88_RS03885 (MUA88_03875) | - | 787507..787713 (+) | 207 | WP_262605801.1 | hypothetical protein | - |
| MUA88_RS03890 (MUA88_03880) | - | 787771..788310 (-) | 540 | WP_262560540.1 | hypothetical protein | - |
| MUA88_RS03895 (MUA88_03885) | - | 788390..788554 (+) | 165 | WP_346658230.1 | hypothetical protein | - |
| MUA88_RS03900 (MUA88_03890) | - | 788654..788977 (+) | 324 | WP_262605802.1 | DUF771 domain-containing protein | - |
| MUA88_RS03905 (MUA88_03895) | - | 788979..789158 (+) | 180 | WP_262605803.1 | hypothetical protein | - |
| MUA88_RS03910 (MUA88_03900) | - | 789240..789509 (+) | 270 | WP_262605804.1 | DUF1108 family protein | - |
| MUA88_RS03915 (MUA88_03905) | - | 789510..789992 (+) | 483 | WP_262605805.1 | siphovirus Gp157 family protein | - |
| MUA88_RS03920 (MUA88_03910) | - | 789992..790663 (+) | 672 | WP_262605806.1 | ERF family protein | - |
| MUA88_RS03925 (MUA88_03915) | ssb | 790663..791079 (+) | 417 | WP_262605807.1 | single-stranded DNA-binding protein | Machinery gene |
| MUA88_RS03930 (MUA88_03920) | - | 791091..791765 (+) | 675 | WP_262605808.1 | putative HNHc nuclease | - |
| MUA88_RS03935 (MUA88_03925) | - | 791781..792263 (-) | 483 | WP_262605809.1 | hypothetical protein | - |
| MUA88_RS03940 (MUA88_03930) | - | 792318..793073 (+) | 756 | WP_262605811.1 | conserved phage C-terminal domain-containing protein | - |
| MUA88_RS03945 (MUA88_03935) | - | 793045..793398 (+) | 354 | WP_262605812.1 | hypothetical protein | - |
| MUA88_RS03950 (MUA88_03940) | - | 793391..794629 (+) | 1239 | WP_262605813.1 | DnaB helicase C-terminal domain-containing protein | - |
| MUA88_RS03955 (MUA88_03945) | - | 794626..794844 (+) | 219 | WP_262604830.1 | hypothetical protein | - |
| MUA88_RS03960 (MUA88_03950) | - | 794831..795247 (+) | 417 | WP_262604831.1 | RusA family crossover junction endodeoxyribonuclease | - |
| MUA88_RS03965 (MUA88_03955) | - | 795344..795517 (+) | 174 | WP_262604832.1 | helix-turn-helix domain-containing protein | - |
| MUA88_RS03970 (MUA88_03960) | - | 795675..795893 (+) | 219 | WP_262604833.1 | hypothetical protein | - |
| MUA88_RS03975 (MUA88_03965) | - | 795886..796086 (+) | 201 | WP_262605814.1 | hypothetical protein | - |
| MUA88_RS03980 (MUA88_03970) | - | 796073..796360 (+) | 288 | WP_262605815.1 | hypothetical protein | - |
| MUA88_RS03985 (MUA88_03975) | - | 796360..796878 (+) | 519 | WP_262605816.1 | dUTP pyrophosphatase | - |
| MUA88_RS03990 (MUA88_03980) | - | 796915..797064 (+) | 150 | WP_262605817.1 | DUF1381 domain-containing protein | - |
| MUA88_RS03995 (MUA88_03985) | - | 797057..797239 (+) | 183 | WP_262605818.1 | transcriptional activator RinB | - |
| MUA88_RS04000 (MUA88_03990) | - | 797239..797466 (+) | 228 | WP_262605819.1 | hypothetical protein | - |
| MUA88_RS04005 (MUA88_03995) | - | 797680..798078 (+) | 399 | WP_262605820.1 | hypothetical protein | - |
| MUA88_RS04010 (MUA88_04000) | - | 798684..798983 (+) | 300 | WP_262605110.1 | HNH endonuclease | - |
| MUA88_RS04015 (MUA88_04005) | - | 799111..799491 (+) | 381 | WP_262605821.1 | hypothetical protein | - |
| MUA88_RS04020 (MUA88_04010) | - | 799478..801145 (+) | 1668 | WP_262605822.1 | terminase TerL endonuclease subunit | - |
| MUA88_RS04025 (MUA88_04015) | - | 801213..802343 (+) | 1131 | WP_262605823.1 | phage portal protein | - |
| MUA88_RS04030 (MUA88_04020) | - | 802306..803019 (+) | 714 | WP_262605824.1 | head maturation protease, ClpP-related | - |
| MUA88_RS04035 (MUA88_04025) | - | 803031..804230 (+) | 1200 | WP_262605825.1 | phage major capsid protein | - |
| MUA88_RS04040 (MUA88_04030) | - | 804248..804535 (+) | 288 | WP_262605826.1 | phage gp6-like head-tail connector protein | - |
| MUA88_RS04045 (MUA88_04035) | - | 804519..804887 (+) | 369 | WP_262605827.1 | hypothetical protein | - |
| MUA88_RS04050 (MUA88_04040) | - | 804877..805278 (+) | 402 | WP_262605828.1 | HK97 gp10 family phage protein | - |
| MUA88_RS04055 (MUA88_04045) | - | 805284..805694 (+) | 411 | WP_262605829.1 | hypothetical protein | - |
| MUA88_RS04060 (MUA88_04050) | - | 805707..806330 (+) | 624 | WP_262605830.1 | major tail protein | - |
| MUA88_RS04065 (MUA88_04055) | - | 806342..806527 (+) | 186 | WP_262605940.1 | hypothetical protein | - |
| MUA88_RS04070 (MUA88_04060) | - | 806595..806966 (+) | 372 | WP_262605831.1 | hypothetical protein | - |
| MUA88_RS04075 (MUA88_04065) | - | 807026..807169 (+) | 144 | WP_262605833.1 | hypothetical protein | - |
| MUA88_RS04080 (MUA88_04070) | - | 807186..812123 (+) | 4938 | WP_262605834.1 | phage tail tape measure protein | - |
| MUA88_RS04085 (MUA88_04075) | - | 812120..813628 (+) | 1509 | WP_262605835.1 | phage tail family protein | - |
| MUA88_RS04090 (MUA88_04080) | - | 813644..817984 (+) | 4341 | WP_262605836.1 | phage tail spike protein | - |
| MUA88_RS04095 (MUA88_04085) | - | 817971..818138 (+) | 168 | WP_262605837.1 | hypothetical protein | - |
| MUA88_RS04100 (MUA88_04090) | - | 818181..818471 (+) | 291 | WP_262605838.1 | hypothetical protein | - |
| MUA88_RS04105 (MUA88_04095) | - | 818471..818962 (+) | 492 | WP_262605839.1 | phage holin family protein | - |
| MUA88_RS04110 (MUA88_04100) | - | 818998..820467 (+) | 1470 | WP_262605840.1 | SH3 domain-containing protein | - |
| MUA88_RS04115 (MUA88_04105) | - | 820814..822724 (+) | 1911 | WP_262605841.1 | SAM-dependent methyltransferase | - |
| MUA88_RS04120 (MUA88_04110) | - | 822702..823718 (+) | 1017 | WP_262605842.1 | restriction endonuclease subunit S | - |
| MUA88_RS04125 (MUA88_04115) | - | 823741..824307 (+) | 567 | Protein_797 | N-acetylmuramoyl-L-alanine amidase | - |
| MUA88_RS04130 (MUA88_04120) | - | 824466..825128 (+) | 663 | WP_262604856.1 | hypothetical protein | - |
| MUA88_RS04135 (MUA88_04125) | - | 825142..825783 (+) | 642 | WP_262604857.1 | hypothetical protein | - |
| MUA88_RS10915 | - | 826210..826326 (+) | 117 | WP_346014880.1 | hypothetical protein | - |
| MUA88_RS04140 (MUA88_04130) | - | 826319..826507 (+) | 189 | WP_262605844.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 138 a.a. Molecular weight: 15651.27 Da Isoelectric Point: 7.7800
>NTDB_id=671127 MUA88_RS03925 WP_262605807.1 790663..791079(+) (ssb) [Staphylococcus sp. IVB6240]
MINRVVLAGRLTKAPEFRTTQSGVEVATFTLAVNRNYKNKNGEQQADFINCIVFRKQAENVKNYLNKGNLAGVDGRLQSR
SYENQEGRRVYVTEVVCDSVQFLEPKNNSQSNNQPKQQGQAQNNPFDNSDDEFSDLPF
MINRVVLAGRLTKAPEFRTTQSGVEVATFTLAVNRNYKNKNGEQQADFINCIVFRKQAENVKNYLNKGNLAGVDGRLQSR
SYENQEGRRVYVTEVVCDSVQFLEPKNNSQSNNQPKQQGQAQNNPFDNSDDEFSDLPF
Nucleotide
Download Length: 417 bp
>NTDB_id=671127 MUA88_RS03925 WP_262605807.1 790663..791079(+) (ssb) [Staphylococcus sp. IVB6240]
ATGATTAATAGAGTCGTATTAGCAGGACGATTAACAAAAGCCCCCGAATTCAGAACAACGCAATCAGGCGTGGAGGTAGC
AACTTTTACATTGGCAGTTAACCGCAATTACAAAAATAAAAACGGAGAACAACAAGCAGATTTTATAAACTGTATTGTTT
TTCGTAAGCAAGCAGAAAATGTGAAAAACTATCTAAATAAAGGAAATCTTGCAGGTGTAGATGGCCGCTTACAATCACGC
AGTTATGAAAACCAAGAAGGCCGACGTGTTTATGTAACTGAAGTCGTTTGCGACAGCGTGCAATTTTTAGAACCTAAAAA
TAATAGCCAATCTAACAATCAACCTAAACAACAAGGACAAGCGCAGAATAATCCTTTTGATAACAGTGATGACGAGTTCT
CGGATTTACCTTTCTAG
ATGATTAATAGAGTCGTATTAGCAGGACGATTAACAAAAGCCCCCGAATTCAGAACAACGCAATCAGGCGTGGAGGTAGC
AACTTTTACATTGGCAGTTAACCGCAATTACAAAAATAAAAACGGAGAACAACAAGCAGATTTTATAAACTGTATTGTTT
TTCGTAAGCAAGCAGAAAATGTGAAAAACTATCTAAATAAAGGAAATCTTGCAGGTGTAGATGGCCGCTTACAATCACGC
AGTTATGAAAACCAAGAAGGCCGACGTGTTTATGTAACTGAAGTCGTTTGCGACAGCGTGCAATTTTTAGAACCTAAAAA
TAATAGCCAATCTAACAATCAACCTAAACAACAAGGACAAGCGCAGAATAATCCTTTTGATAACAGTGATGACGAGTTCT
CGGATTTACCTTTCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
47.977 |
100 |
0.601 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
70.093 |
77.536 |
0.543 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
57.547 |
76.812 |
0.442 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
40.426 |
100 |
0.413 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
39.716 |
100 |
0.406 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
39.716 |
100 |
0.406 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
39.007 |
100 |
0.399 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
39.007 |
100 |
0.399 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
39.007 |
100 |
0.399 |
| ssbB/cilA | Streptococcus mitis SK321 |
39.007 |
100 |
0.399 |
| ssbA | Streptococcus mutans UA159 |
38.298 |
100 |
0.391 |