Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | MQP46_RS04160 | Genome accession | NZ_CP093935 |
| Coordinates | 864679..865107 (+) | Length | 142 a.a. |
| NCBI ID | WP_000934385.1 | Uniprot ID | A0A2K0CLZ8 |
| Organism | Staphylococcus aureus strain WA121-2021_16354 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 855262..905520 | 864679..865107 | within | 0 |
Gene organization within MGE regions
Location: 855262..905520
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MQP46_RS04075 (MQP46_04075) | sufB | 855262..856659 (+) | 1398 | WP_001074405.1 | Fe-S cluster assembly protein SufB | - |
| MQP46_RS04080 (MQP46_04080) | - | 856727..857776 (-) | 1050 | WP_001145737.1 | tyrosine-type recombinase/integrase | - |
| MQP46_RS04085 (MQP46_04085) | - | 857889..858068 (+) | 180 | WP_000337826.1 | hypothetical protein | - |
| MQP46_RS04090 (MQP46_04090) | - | 858048..858980 (-) | 933 | WP_000392186.1 | hypothetical protein | - |
| MQP46_RS04095 (MQP46_04095) | - | 859012..859737 (-) | 726 | WP_000661437.1 | PH domain-containing protein | - |
| MQP46_RS04100 (MQP46_04100) | - | 859765..860439 (-) | 675 | WP_000775187.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MQP46_RS04105 (MQP46_04105) | - | 860456..860788 (-) | 333 | WP_001055143.1 | helix-turn-helix transcriptional regulator | - |
| MQP46_RS04110 (MQP46_04110) | - | 861051..861245 (+) | 195 | WP_000108122.1 | helix-turn-helix transcriptional regulator | - |
| MQP46_RS04115 (MQP46_04115) | - | 861245..862012 (+) | 768 | WP_001002757.1 | phage antirepressor Ant | - |
| MQP46_RS04120 (MQP46_04120) | - | 862013..862237 (+) | 225 | WP_000187184.1 | hypothetical protein | - |
| MQP46_RS04125 (MQP46_04125) | - | 862277..862345 (+) | 69 | Protein_802 | hypothetical protein | - |
| MQP46_RS04130 (MQP46_04130) | - | 862366..863031 (-) | 666 | WP_001807461.1 | hypothetical protein | - |
| MQP46_RS04135 (MQP46_04135) | - | 863103..863324 (+) | 222 | WP_221916188.1 | hypothetical protein | - |
| MQP46_RS04140 (MQP46_04140) | - | 863317..863478 (+) | 162 | WP_000066011.1 | DUF1270 domain-containing protein | - |
| MQP46_RS04145 (MQP46_04145) | - | 863572..863832 (+) | 261 | WP_050960935.1 | DUF1108 family protein | - |
| MQP46_RS04150 (MQP46_04150) | - | 863842..864063 (+) | 222 | WP_000815402.1 | DUF2483 family protein | - |
| MQP46_RS04155 (MQP46_04155) | - | 864056..864679 (+) | 624 | WP_000139720.1 | DUF1071 domain-containing protein | - |
| MQP46_RS04160 (MQP46_04160) | ssbA | 864679..865107 (+) | 429 | WP_000934385.1 | single-stranded DNA-binding protein | Machinery gene |
| MQP46_RS04165 (MQP46_04165) | - | 865121..865795 (+) | 675 | WP_020444663.1 | putative HNHc nuclease | - |
| MQP46_RS04170 (MQP46_04170) | - | 865905..866564 (-) | 660 | WP_016028252.1 | hypothetical protein | - |
| MQP46_RS04175 (MQP46_04175) | - | 866610..867380 (+) | 771 | WP_000190226.1 | conserved phage C-terminal domain-containing protein | - |
| MQP46_RS04180 (MQP46_04180) | - | 867390..868163 (+) | 774 | WP_000803028.1 | ATP-binding protein | - |
| MQP46_RS04185 (MQP46_04185) | - | 868157..868315 (+) | 159 | WP_000256597.1 | hypothetical protein | - |
| MQP46_RS04190 (MQP46_04190) | - | 868329..868550 (+) | 222 | WP_089519265.1 | DUF3269 family protein | - |
| MQP46_RS04195 (MQP46_04195) | - | 868561..868965 (+) | 405 | WP_000049795.1 | DUF1064 domain-containing protein | - |
| MQP46_RS04200 (MQP46_04200) | - | 868970..869155 (+) | 186 | WP_001187244.1 | DUF3113 family protein | - |
| MQP46_RS04205 (MQP46_04205) | - | 869156..869527 (+) | 372 | WP_001140291.1 | SA1788 family PVL leukocidin-associated protein | - |
| MQP46_RS04210 (MQP46_04210) | - | 869527..869781 (+) | 255 | WP_000022719.1 | DUF3310 domain-containing protein | - |
| MQP46_RS04215 (MQP46_04215) | - | 869781..870029 (+) | 249 | WP_060474161.1 | SAV1978 family virulence-associated passenger protein | - |
| MQP46_RS04220 (MQP46_04220) | - | 870043..870249 (+) | 207 | WP_000693989.1 | hypothetical protein | - |
| MQP46_RS04225 (MQP46_04225) | - | 870252..870656 (+) | 405 | WP_000695756.1 | hypothetical protein | - |
| MQP46_RS04230 (MQP46_04230) | - | 870653..871069 (+) | 417 | WP_000175227.1 | YopX family protein | - |
| MQP46_RS04235 (MQP46_04235) | - | 871066..871431 (+) | 366 | WP_001105613.1 | hypothetical protein | - |
| MQP46_RS04240 (MQP46_04240) | - | 871424..871678 (+) | 255 | WP_001065113.1 | DUF1024 family protein | - |
| MQP46_RS04245 (MQP46_04245) | - | 871665..871835 (+) | 171 | WP_000714413.1 | hypothetical protein | - |
| MQP46_RS04250 (MQP46_04250) | - | 871828..872364 (+) | 537 | WP_000181824.1 | dUTPase | - |
| MQP46_RS04255 (MQP46_04255) | - | 872401..872688 (+) | 288 | WP_000195742.1 | DUF1381 domain-containing protein | - |
| MQP46_RS04260 (MQP46_04260) | - | 872681..872917 (+) | 237 | WP_000608282.1 | hypothetical protein | - |
| MQP46_RS04265 (MQP46_04265) | - | 872907..873296 (+) | 390 | WP_078064095.1 | hypothetical protein | - |
| MQP46_RS04270 (MQP46_04270) | - | 873293..873466 (+) | 174 | WP_000595302.1 | transcriptional activator RinB | - |
| MQP46_RS04275 (MQP46_04275) | - | 873467..873868 (+) | 402 | WP_000286968.1 | hypothetical protein | - |
| MQP46_RS04280 (MQP46_04280) | - | 874223..874717 (+) | 495 | WP_000594088.1 | terminase small subunit | - |
| MQP46_RS04285 (MQP46_04285) | - | 874710..875933 (+) | 1224 | WP_001037578.1 | PBSX family phage terminase large subunit | - |
| MQP46_RS04290 (MQP46_04290) | - | 875930..877354 (+) | 1425 | WP_000177422.1 | phage portal protein | - |
| MQP46_RS04295 (MQP46_04295) | - | 877323..878276 (+) | 954 | WP_000184143.1 | phage head morphogenesis protein | - |
| MQP46_RS04300 (MQP46_04300) | - | 878278..878484 (+) | 207 | WP_000346033.1 | hypothetical protein | - |
| MQP46_RS04305 (MQP46_04305) | - | 878587..879171 (+) | 585 | WP_001019220.1 | DUF4355 domain-containing protein | - |
| MQP46_RS04310 (MQP46_04310) | - | 879188..880102 (+) | 915 | WP_000235168.1 | phage major capsid protein | - |
| MQP46_RS04315 (MQP46_04315) | - | 880114..880257 (+) | 144 | WP_000002931.1 | hypothetical protein | - |
| MQP46_RS04320 (MQP46_04320) | - | 880263..880613 (+) | 351 | WP_000177351.1 | phage head-tail adapter protein | - |
| MQP46_RS04325 (MQP46_04325) | - | 880625..880960 (+) | 336 | WP_000483041.1 | phage head closure protein | - |
| MQP46_RS04330 (MQP46_04330) | - | 880947..881354 (+) | 408 | WP_001151323.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| MQP46_RS04335 (MQP46_04335) | - | 881367..881792 (+) | 426 | WP_000270189.1 | DUF3168 domain-containing protein | - |
| MQP46_RS04340 (MQP46_04340) | - | 881793..882350 (+) | 558 | WP_000057582.1 | tail protein | - |
| MQP46_RS04345 (MQP46_04345) | - | 882417..882923 (+) | 507 | WP_000134337.1 | tail assembly chaperone | - |
| MQP46_RS04350 (MQP46_04350) | - | 882968..883252 (+) | 285 | WP_000880588.1 | hypothetical protein | - |
| MQP46_RS04355 (MQP46_04355) | - | 883256..886141 (+) | 2886 | WP_000379450.1 | terminase | - |
| MQP46_RS04360 (MQP46_04360) | - | 886156..887097 (+) | 942 | WP_000560187.1 | phage tail domain-containing protein | - |
| MQP46_RS04365 (MQP46_04365) | - | 887108..888994 (+) | 1887 | WP_001121997.1 | phage tail protein | - |
| MQP46_RS04370 (MQP46_04370) | - | 889007..890905 (+) | 1899 | WP_064133579.1 | hypothetical protein | - |
| MQP46_RS04375 (MQP46_04375) | - | 890905..892728 (+) | 1824 | WP_000634514.1 | BppU family phage baseplate upper protein | - |
| MQP46_RS04380 (MQP46_04380) | - | 892728..893105 (+) | 378 | WP_000705914.1 | DUF2977 domain-containing protein | - |
| MQP46_RS04385 (MQP46_04385) | - | 893115..893288 (+) | 174 | WP_001790193.1 | XkdX family protein | - |
| MQP46_RS04390 (MQP46_04390) | - | 893329..893628 (+) | 300 | WP_000466769.1 | DUF2951 domain-containing protein | - |
| MQP46_RS04395 (MQP46_04395) | - | 893765..895639 (+) | 1875 | WP_000524049.1 | glucosaminidase domain-containing protein | - |
| MQP46_RS04400 (MQP46_04400) | - | 895652..896890 (+) | 1239 | WP_000276651.1 | BppU family phage baseplate upper protein | - |
| MQP46_RS04405 (MQP46_04405) | - | 896895..897290 (+) | 396 | WP_000398877.1 | hypothetical protein | - |
| MQP46_RS04410 (MQP46_04410) | - | 897346..897621 (+) | 276 | WP_000351119.1 | phage holin | - |
| MQP46_RS04415 (MQP46_04415) | - | 897608..899020 (+) | 1413 | WP_001141520.1 | N-acetylmuramoyl-L-alanine amidase | - |
| MQP46_RS04420 (MQP46_04420) | - | 899080..899637 (-) | 558 | WP_001035621.1 | DUF4888 domain-containing protein | - |
| MQP46_RS04425 (MQP46_04425) | - | 900502..900641 (+) | 140 | Protein_862 | hypothetical protein | - |
| MQP46_RS04430 (MQP46_04430) | - | 900647..900961 (-) | 315 | WP_000274029.1 | hypothetical protein | - |
| MQP46_RS04435 (MQP46_04435) | - | 901326..902366 (+) | 1041 | WP_000582326.1 | CNNM domain-containing protein | - |
| MQP46_RS04440 (MQP46_04440) | - | 902380..903447 (+) | 1068 | WP_000267236.1 | nitronate monooxygenase family protein | - |
| MQP46_RS04445 (MQP46_04445) | - | 903701..903784 (+) | 84 | WP_016170465.1 | hypothetical protein | - |
| MQP46_RS04450 (MQP46_04450) | - | 903832..904680 (+) | 849 | WP_000608129.1 | DUF72 domain-containing protein | - |
| MQP46_RS04455 (MQP46_04455) | - | 904693..905520 (+) | 828 | WP_000927632.1 | sulfite exporter TauE/SafE family protein | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 15872.58 Da Isoelectric Point: 8.4825
>NTDB_id=665708 MQP46_RS04160 WP_000934385.1 864679..865107(+) (ssbA) [Staphylococcus aureus strain WA121-2021_16354]
MLNRAVLVGRLTKDPELRSAPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
MLNRAVLVGRLTKDPELRSAPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
Nucleotide
Download Length: 429 bp
>NTDB_id=665708 MQP46_RS04160 WP_000934385.1 864679..865107(+) (ssbA) [Staphylococcus aureus strain WA121-2021_16354]
ATGTTAAACAGAGCAGTATTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCGCGCCAAATGGCGTAAATGTAGG
TACATTCACATTGGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAGAAACAAGCTGAAAATGTTAAAAACTACCTTTCTAAAGGGTCGCTGGCAGGTGTAGACGGGCGACTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
ATGTTAAACAGAGCAGTATTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCGCGCCAAATGGCGTAAATGTAGG
TACATTCACATTGGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAGAAACAAGCTGAAAATGTTAAAAACTACCTTTCTAAAGGGTCGCTGGCAGGTGTAGACGGGCGACTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
58.14 |
100 |
0.704 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.606 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
74.648 |
0.437 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
41.958 |
100 |
0.423 |
| ssbA | Streptococcus mutans UA159 |
40.845 |
100 |
0.408 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus mitis SK321 |
39.437 |
100 |
0.394 |