Detailed information NTG0633543

Bioinformatically predicted

Overview

• Name: pilA2
• Type: Machinery gene
• Locus tag: LQ771_RS03815
• Genome accession: NZ_CP088252
• Coordinates: 835980..836444 (-)
• Length: 154 a.a.
• NCBI ID: WP_231351053.1
• Uniprot ID: -
• Organism: Frateuria soli strain 5GH9-11
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	824575..838661	835980..836444	within	0

Gene organization within MGE regions

Location: 824575..838661

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LQ771_RS03770 (LQ771_03770)	-	824575..825717 (+)	1143	WP_231351044.1	glycosyltransferase family 4 protein	-
LQ771_RS03775 (LQ771_03775)	-	825890..826810 (+)	921	WP_231351045.1	glycosyltransferase	-
LQ771_RS03780 (LQ771_03780)	-	826803..827918 (+)	1116	WP_231351046.1	DegT/DnrJ/EryC1/StrS family aminotransferase	-
LQ771_RS03785 (LQ771_03785)	-	827915..828487 (+)	573	WP_231351047.1	acyltransferase	-
LQ771_RS03790 (LQ771_03790)	-	828484..829983 (+)	1500	WP_231351048.1	oligosaccharide flippase family protein	-
LQ771_RS03795 (LQ771_03795)	-	829973..830911 (+)	939	WP_231351049.1	glycosyltransferase	-
LQ771_RS03800 (LQ771_03800)	-	830922..831719 (+)	798	WP_231351050.1	class I SAM-dependent methyltransferase	-
LQ771_RS03805 (LQ771_03805)	-	831898..833835 (-)	1938	WP_231351051.1	hypothetical protein	-
LQ771_RS03810 (LQ771_03810)	-	833874..835868 (-)	1995	WP_231351052.1	tetratricopeptide repeat protein	-
LQ771_RS03815 (LQ771_03815)	pilA2	835980..836444 (-)	465	WP_231351053.1	pilin	Machinery gene
LQ771_RS03820 (LQ771_03820)	pilE	836773..837216 (-)	444	WP_231351054.1	pilin	Machinery gene
LQ771_RS03825 (LQ771_03825)	-	837306..838661 (-)	1356	WP_231351055.1	hypothetical protein	-

Sequence

Protein

• Length: 154 a.a.
• Molecular weight: 16006.16 Da
• Isoelectric Point: 5.7020

>NTDB_id=633543 LQ771_RS03815 WP_231351053.1 835980..836444(-) (pilA2) [Frateuria soli strain 5GH9-11]
MKKTIQKGFTLIELMIVIAIIAILAAIAIPAYQDYVIRTQVSEGMSLADGAKTAVAEFYTNTGRLPGNNESAGLSSAGSI
NGQYVSQIGVGSDGDGTDGVIEAQYDGPKANTAIKGADGTLVLSPITHAGSVEWHCKGDGTKVKDKYLPASCRQ

Nucleotide

• Length: 465 bp

>NTDB_id=633543 LQ771_RS03815 WP_231351053.1 835980..836444(-) (pilA2) [Frateuria soli strain 5GH9-11]
ATGAAGAAGACCATCCAGAAGGGCTTCACCCTCATCGAACTGATGATCGTGATCGCCATCATCGCCATCCTGGCGGCCAT
CGCGATCCCGGCCTACCAGGATTACGTGATCCGCACGCAGGTCTCCGAAGGCATGTCGCTCGCCGACGGCGCCAAGACCG
CCGTGGCCGAGTTCTACACCAACACCGGTCGTCTGCCTGGCAACAATGAGTCGGCTGGTCTCTCCAGCGCCGGGAGCATC
AACGGCCAGTACGTCAGCCAGATCGGCGTCGGTTCTGATGGTGACGGTACGGACGGCGTGATCGAGGCCCAGTACGACGG
TCCGAAGGCGAATACCGCGATCAAGGGTGCCGACGGCACTCTCGTCCTCTCTCCCATCACCCACGCTGGTTCGGTGGAAT
GGCACTGCAAGGGCGACGGCACCAAGGTCAAGGACAAGTACCTGCCAGCTTCCTGCCGTCAGTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-28)

• Pilin (bacterial filament) (Pilin) (38-153)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilA2	Legionella pneumophila str. Paris	50.667	97.403	0.494
pilE	Neisseria gonorrhoeae MS11	45.455	100	0.487
pilE	Neisseria gonorrhoeae strain FA1090	45.732	100	0.487
pilA2	Legionella pneumophila strain ERS1305867	50	97.403	0.487
pilA	Ralstonia pseudosolanacearum GMI1000	38.418	100	0.442
comP	Acinetobacter baylyi ADP1	44.079	98.701	0.435
pilA/pilA1	Eikenella corrodens VA1	38.65	100	0.409
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	35.503	100	0.39
pilA	Haemophilus influenzae 86-028NP	40.278	93.506	0.377