Detailed information
Overview
| Name | comYC | Type | Machinery gene |
| Locus tag | LOD77_RS09260 | Genome accession | NZ_CP086728 |
| Coordinates | 1825360..1825677 (-) | Length | 105 a.a. |
| NCBI ID | WP_274505424.1 | Uniprot ID | - |
| Organism | Streptococcus parasuis strain SS20 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1823808..1852545 | 1825360..1825677 | within | 0 |
Gene organization within MGE regions
Location: 1823808..1852545
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LOD77_RS09240 (LOD77_09220) | comGG | 1823808..1824308 (-) | 501 | WP_171989710.1 | competence type IV pilus minor pilin ComGG | - |
| LOD77_RS09245 (LOD77_09225) | comYF | 1824286..1824720 (-) | 435 | WP_216806339.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| LOD77_RS09250 (LOD77_09230) | comGE | 1824707..1825000 (-) | 294 | WP_105126461.1 | competence type IV pilus minor pilin ComGE | - |
| LOD77_RS09255 (LOD77_09235) | comGD | 1824972..1825376 (-) | 405 | WP_171989707.1 | competence type IV pilus minor pilin ComGD | - |
| LOD77_RS09260 (LOD77_09240) | comYC | 1825360..1825677 (-) | 318 | WP_274505424.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| LOD77_RS09265 (LOD77_09245) | comYB | 1825679..1826716 (-) | 1038 | WP_216806336.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| LOD77_RS09270 (LOD77_09250) | comYA | 1826628..1827578 (-) | 951 | WP_171989704.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| LOD77_RS09275 (LOD77_09255) | - | 1827666..1828616 (+) | 951 | WP_274505425.1 | S66 peptidase family protein | - |
| LOD77_RS09280 (LOD77_09260) | - | 1828649..1829017 (-) | 369 | WP_171989702.1 | DUF1033 family protein | - |
| LOD77_RS09285 (LOD77_09265) | rpoC | 1829142..1832786 (-) | 3645 | WP_274505426.1 | DNA-directed RNA polymerase subunit beta' | - |
| LOD77_RS09290 (LOD77_09270) | rpoB | 1832965..1836537 (-) | 3573 | WP_174846402.1 | DNA-directed RNA polymerase subunit beta | - |
| LOD77_RS09295 (LOD77_09275) | pbp1b | 1837200..1839605 (-) | 2406 | WP_274505427.1 | penicillin-binding protein PBP1B | - |
| LOD77_RS09300 (LOD77_09280) | tyrS | 1839752..1841008 (+) | 1257 | WP_274505428.1 | tyrosine--tRNA ligase | - |
| LOD77_RS09305 (LOD77_09285) | - | 1841065..1841442 (+) | 378 | WP_171989697.1 | HIT family protein | - |
| LOD77_RS09310 (LOD77_09290) | - | 1841554..1841838 (+) | 285 | WP_171989696.1 | PASTA domain-containing protein | - |
| LOD77_RS09315 (LOD77_09295) | - | 1841849..1842265 (+) | 417 | WP_274505429.1 | PASTA domain-containing protein | - |
| LOD77_RS09320 (LOD77_09300) | - | 1842314..1842523 (-) | 210 | WP_130554922.1 | heavy metal-associated domain-containing protein | - |
| LOD77_RS09325 (LOD77_09305) | - | 1842691..1843140 (-) | 450 | WP_216806329.1 | CopY/TcrY family copper transport repressor | - |
| LOD77_RS09330 (LOD77_09310) | - | 1843241..1844749 (-) | 1509 | WP_216806328.1 | zinc ABC transporter substrate-binding protein AdcA | - |
| LOD77_RS09335 (LOD77_09315) | - | 1844759..1845571 (-) | 813 | WP_130554925.1 | metal ABC transporter permease | - |
| LOD77_RS09340 (LOD77_09320) | - | 1845564..1846268 (-) | 705 | WP_216806327.1 | metal ABC transporter ATP-binding protein | - |
| LOD77_RS09345 (LOD77_09325) | - | 1846269..1846712 (-) | 444 | WP_171989690.1 | zinc-dependent MarR family transcriptional regulator | - |
| LOD77_RS09350 (LOD77_09330) | - | 1847362..1848135 (-) | 774 | WP_087063181.1 | nucleoside phosphorylase | - |
| LOD77_RS09355 (LOD77_09335) | - | 1848281..1848733 (-) | 453 | WP_274505430.1 | helix-turn-helix transcriptional regulator | - |
| LOD77_RS09360 (LOD77_09340) | - | 1849055..1849528 (+) | 474 | WP_174846396.1 | hypothetical protein | - |
| LOD77_RS09365 (LOD77_09345) | - | 1849662..1850765 (+) | 1104 | WP_337999565.1 | replication initiation factor domain-containing protein | - |
| LOD77_RS09370 (LOD77_09350) | - | 1850768..1851154 (+) | 387 | WP_121795882.1 | hypothetical protein | - |
| LOD77_RS09375 (LOD77_09355) | - | 1851214..1851408 (+) | 195 | WP_021144813.1 | DUF3173 domain-containing protein | - |
| LOD77_RS09380 (LOD77_09360) | - | 1851412..1852545 (+) | 1134 | WP_274505432.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 105 a.a. Molecular weight: 12088.16 Da Isoelectric Point: 4.9669
>NTDB_id=626217 LOD77_RS09260 WP_274505424.1 1825360..1825677(-) (comYC) [Streptococcus parasuis strain SS20]
MKKMLKKKVKGFTLIEMLIVLGIISILLLLFVPNLSEQKQKIQEDGNAAVVKVVESQMDIYELDHGVRPTAEELEKSEMI
TEDQLEKYNNVPKEQLKEYNNAPKE
MKKMLKKKVKGFTLIEMLIVLGIISILLLLFVPNLSEQKQKIQEDGNAAVVKVVESQMDIYELDHGVRPTAEELEKSEMI
TEDQLEKYNNVPKEQLKEYNNAPKE
Nucleotide
Download Length: 318 bp
>NTDB_id=626217 LOD77_RS09260 WP_274505424.1 1825360..1825677(-) (comYC) [Streptococcus parasuis strain SS20]
ATGAAAAAAATGTTGAAAAAGAAAGTCAAAGGATTCACTTTGATTGAAATGTTAATTGTGCTTGGAATTATTAGTATTCT
CTTGCTATTATTTGTGCCAAATCTCAGTGAGCAGAAGCAAAAAATACAAGAAGACGGCAATGCGGCGGTTGTAAAAGTTG
TTGAAAGTCAAATGGACATTTACGAATTGGACCATGGTGTTCGTCCAACAGCGGAAGAATTAGAAAAATCGGAGATGATA
ACTGAAGATCAACTAGAAAAATATAATAATGTACCTAAAGAACAACTCAAAGAGTACAATAATGCACCTAAAGAATAA
ATGAAAAAAATGTTGAAAAAGAAAGTCAAAGGATTCACTTTGATTGAAATGTTAATTGTGCTTGGAATTATTAGTATTCT
CTTGCTATTATTTGTGCCAAATCTCAGTGAGCAGAAGCAAAAAATACAAGAAGACGGCAATGCGGCGGTTGTAAAAGTTG
TTGAAAGTCAAATGGACATTTACGAATTGGACCATGGTGTTCGTCCAACAGCGGAAGAATTAGAAAAATCGGAGATGATA
ACTGAAGATCAACTAGAAAAATATAATAATGTACCTAAAGAACAACTCAAAGAGTACAATAATGCACCTAAAGAATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comYC | Streptococcus suis isolate S10 |
61.29 |
88.571 |
0.543 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
53.465 |
96.19 |
0.514 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
49.524 |
100 |
0.495 |
| comGC/cglC | Streptococcus mitis SK321 |
54.839 |
88.571 |
0.486 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
54.348 |
87.619 |
0.476 |
| comYC | Streptococcus mutans UA159 |
54.444 |
85.714 |
0.467 |
| comYC | Streptococcus mutans UA140 |
54.444 |
85.714 |
0.467 |
| comGC/cglC | Streptococcus pneumoniae D39 |
52.174 |
87.619 |
0.457 |
| comGC/cglC | Streptococcus pneumoniae R6 |
52.174 |
87.619 |
0.457 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
52.174 |
87.619 |
0.457 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
52.809 |
84.762 |
0.448 |
| comGC | Staphylococcus aureus MW2 |
48.101 |
75.238 |
0.362 |
| comGC | Staphylococcus aureus N315 |
48.101 |
75.238 |
0.362 |