Detailed information NTG0061850

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: SCR2_RS08585
• Genome accession: NC_022245
• Coordinates: 1732060..1732377 (-)
• Length: 105 a.a.
• NCBI ID: WP_020998068.1
• Uniprot ID: U2XY26
• Organism: Streptococcus constellatus subsp. pharyngis C818
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1727060..1737377

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SCR2_RS08555 (SCR2_1681)	-	1728395..1729594 (-)	1200	WP_006267970.1	acetate kinase	-
SCR2_RS08560 (SCR2_1682)	comYH	1729641..1730594 (-)	954	WP_020998065.1	class I SAM-dependent methyltransferase	Machinery gene
SCR2_RS08565 (SCR2_1683)	comGG	1730679..1731005 (-)	327	WP_020998066.1	competence type IV pilus minor pilin ComGG	-
SCR2_RS08570 (SCR2_1684)	comGF/cglF	1730986..1731423 (-)	438	WP_003035329.1	competence type IV pilus minor pilin ComGF	Machinery gene
SCR2_RS08575 (SCR2_1685)	comGE/cglE	1731407..1731700 (-)	294	WP_003035318.1	competence type IV pilus minor pilin ComGE	Machinery gene
SCR2_RS08580 (SCR2_1686)	comYD	1731672..1732100 (-)	429	WP_020999411.1	competence type IV pilus minor pilin ComGD	Machinery gene
SCR2_RS08585 (SCR2_1687)	comYC	1732060..1732377 (-)	318	WP_020998068.1	competence type IV pilus major pilin ComGC	Machinery gene
SCR2_RS08590 (SCR2_1688)	comYB	1732374..1733396 (-)	1023	WP_037592679.1	competence type IV pilus assembly protein ComGB	Machinery gene
SCR2_RS08595 (SCR2_1689)	comYA	1733338..1734279 (-)	942	WP_006268058.1	competence type IV pilus ATPase ComGA	Machinery gene
SCR2_RS08600	-	1734349..1734714 (-)	366	WP_022525692.1	DUF1033 family protein	-
SCR2_RS08605 (SCR2_1690)	glnA	1734902..1736248 (-)	1347	WP_020998070.1	type I glutamate--ammonia ligase	-
SCR2_RS08610 (SCR2_1691)	-	1736287..1736646 (-)	360	WP_003073972.1	MerR family transcriptional regulator	-
SCR2_RS08615 (SCR2_1692)	-	1736723..1737253 (-)	531	WP_006268314.1	FUSC family protein	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11678.82 Da
• Isoelectric Point: 10.1006

>NTDB_id=61850 SCR2_RS08585 WP_020998068.1 1732060..1732377(-) (comYC) [Streptococcus constellatus subsp. pharyngis C818]
MKKIKNIKVKAFTLVEMLVVLLIISVLMLLFVPNLTKQKEAVTEKGNAAVVKVVESQAELFEVNHTNEKATLSKLVSEGT
ITDKQAVSYKAYYAKHTKEARTVAD

Nucleotide

• Length: 318 bp

>NTDB_id=61850 SCR2_RS08585 WP_020998068.1 1732060..1732377(-) (comYC) [Streptococcus constellatus subsp. pharyngis C818]
ATGAAAAAAATTAAAAATATAAAGGTAAAAGCTTTCACTTTGGTAGAAATGTTAGTGGTGCTTCTAATCATCAGTGTTTT
GATGCTTTTGTTTGTTCCGAATTTGACCAAACAAAAAGAAGCTGTAACGGAAAAAGGAAATGCAGCTGTTGTGAAGGTTG
TCGAAAGTCAGGCAGAGCTTTTTGAAGTGAATCATACTAATGAAAAAGCGACGCTTTCAAAATTAGTCAGTGAAGGAACT
ATTACAGACAAGCAAGCAGTATCATACAAGGCTTATTATGCAAAACATACAAAAGAAGCTCGCACAGTTGCAGATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-30)

3D structure

• AlphaFold DB: U2XY26

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus gordonii str. Challis substr. CH1	72.381	100	0.724
comYC	Streptococcus mutans UA140	68.571	100	0.686
comYC	Streptococcus mutans UA159	68.571	100	0.686
comGC/cglC	Streptococcus mitis NCTC 12261	69.608	97.143	0.676
comGC/cglC	Streptococcus mitis SK321	68.627	97.143	0.667
comGC/cglC	Streptococcus pneumoniae Rx1	66.667	97.143	0.648
comGC/cglC	Streptococcus pneumoniae D39	66.667	97.143	0.648
comGC/cglC	Streptococcus pneumoniae TIGR4	66.667	97.143	0.648
comGC/cglC	Streptococcus pneumoniae R6	66.667	97.143	0.648
comGC	Lactococcus lactis subsp. cremoris KW2	55.769	99.048	0.552
comYC	Streptococcus suis isolate S10	64.045	84.762	0.543