Detailed information NTG0061624

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: SCI_RS08835
• Genome accession: NC_022238
• Coordinates: 1787554..1787871 (-)
• Length: 105 a.a.
• NCBI ID: WP_020998068.1
• Uniprot ID: U2XY26
• Organism: Streptococcus constellatus subsp. pharyngis C1050
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1782554..1792871

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SCI_RS08805 (SCI_1725)	-	1783889..1785088 (-)	1200	WP_006267970.1	acetate kinase	-
SCI_RS08810 (SCI_1726)	comYH	1785135..1786088 (-)	954	WP_020998065.1	class I SAM-dependent methyltransferase	Machinery gene
SCI_RS08815 (SCI_1727)	comGG	1786173..1786499 (-)	327	WP_020998066.1	competence type IV pilus minor pilin ComGG	-
SCI_RS08820 (SCI_1728)	comGF/cglF	1786480..1786917 (-)	438	WP_003035329.1	competence type IV pilus minor pilin ComGF	Machinery gene
SCI_RS08825 (SCI_1729)	comGE/cglE	1786901..1787194 (-)	294	WP_003035318.1	competence type IV pilus minor pilin ComGE	Machinery gene
SCI_RS08830 (SCI_1730)	comYD	1787166..1787594 (-)	429	WP_020999411.1	competence type IV pilus minor pilin ComGD	Machinery gene
SCI_RS08835 (SCI_1731)	comYC	1787554..1787871 (-)	318	WP_020998068.1	competence type IV pilus major pilin ComGC	Machinery gene
SCI_RS08840 (SCI_1732)	comYB	1787868..1788890 (-)	1023	WP_037592679.1	competence type IV pilus assembly protein ComGB	Machinery gene
SCI_RS08845 (SCI_1733)	comYA	1788832..1789773 (-)	942	WP_006268058.1	competence type IV pilus ATPase ComGA	Machinery gene
SCI_RS08850	-	1789843..1790208 (-)	366	WP_022525692.1	DUF1033 family protein	-
SCI_RS08855 (SCI_1734)	glnA	1790396..1791742 (-)	1347	WP_020998070.1	type I glutamate--ammonia ligase	-
SCI_RS08860 (SCI_1735)	-	1791781..1792140 (-)	360	WP_003073972.1	MerR family transcriptional regulator	-
SCI_RS08865 (SCI_1736)	-	1792217..1792747 (-)	531	WP_006268314.1	aromatic acid exporter family protein	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11678.82 Da
• Isoelectric Point: 10.1006

>NTDB_id=61624 SCI_RS08835 WP_020998068.1 1787554..1787871(-) (comYC) [Streptococcus constellatus subsp. pharyngis C1050]
MKKIKNIKVKAFTLVEMLVVLLIISVLMLLFVPNLTKQKEAVTEKGNAAVVKVVESQAELFEVNHTNEKATLSKLVSEGT
ITDKQAVSYKAYYAKHTKEARTVAD

Nucleotide

• Length: 318 bp

>NTDB_id=61624 SCI_RS08835 WP_020998068.1 1787554..1787871(-) (comYC) [Streptococcus constellatus subsp. pharyngis C1050]
ATGAAAAAAATTAAAAATATAAAGGTAAAAGCTTTCACTTTGGTAGAAATGTTAGTGGTGCTTCTAATCATCAGTGTTTT
GATGCTTTTGTTTGTTCCGAATTTGACCAAACAAAAAGAAGCTGTAACGGAAAAAGGAAATGCAGCTGTTGTGAAGGTTG
TCGAAAGTCAGGCAGAGCTTTTTGAAGTGAATCATACTAATGAAAAAGCGACGCTTTCAAAATTAGTCAGTGAAGGAACT
ATTACAGACAAGCAAGCAGTATCATACAAGGCTTATTATGCAAAACATACAAAAGAAGCTCGCACAGTTGCAGATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-30)

3D structure

• AlphaFold DB: U2XY26

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus gordonii str. Challis substr. CH1	72.381	100	0.724
comYC	Streptococcus mutans UA140	68.571	100	0.686
comYC	Streptococcus mutans UA159	68.571	100	0.686
comGC/cglC	Streptococcus mitis NCTC 12261	69.608	97.143	0.676
comGC/cglC	Streptococcus mitis SK321	68.627	97.143	0.667
comGC/cglC	Streptococcus pneumoniae Rx1	66.667	97.143	0.648
comGC/cglC	Streptococcus pneumoniae D39	66.667	97.143	0.648
comGC/cglC	Streptococcus pneumoniae TIGR4	66.667	97.143	0.648
comGC/cglC	Streptococcus pneumoniae R6	66.667	97.143	0.648
comGC	Lactococcus lactis subsp. cremoris KW2	55.769	99.048	0.552
comYC	Streptococcus suis isolate S10	64.045	84.762	0.543