Detailed information NTG0611344

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: LE167_RS06580
• Genome accession: NZ_CP084443
• Coordinates: 1388995..1389309 (-)
• Length: 104 a.a.
• NCBI ID: WP_002459016.1
• Uniprot ID: -
• Organism: Staphylococcus lugdunensis strain RMLUG5
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1383995..1394309

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LE167_RS06555 (LE167_06580)	gcvPA	1384568..1385917 (-)	1350	WP_002478134.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
LE167_RS06560 (LE167_06585)	gcvT	1385934..1387025 (-)	1092	WP_002478133.1	glycine cleavage system aminomethyltransferase GcvT	-
LE167_RS06565 (LE167_06590)	-	1387195..1387713 (-)	519	WP_002459021.1	shikimate kinase	-
LE167_RS12545 (LE167_06595)	-	1387867..1388325 (-)	459	WP_014533299.1	competence type IV pilus minor pilin ComGF	-
LE167_RS06570 (LE167_06600)	-	1388288..1388581 (-)	294	WP_002478131.1	hypothetical protein	-
LE167_RS06575 (LE167_06605)	comGD	1388568..1389062 (-)	495	WP_225306455.1	competence type IV pilus minor pilin ComGD	-
LE167_RS06580 (LE167_06610)	comGC	1388995..1389309 (-)	315	WP_002459016.1	competence type IV pilus major pilin ComGC	Machinery gene
LE167_RS06585 (LE167_06615)	comGB	1389324..1390388 (-)	1065	WP_002478130.1	competence type IV pilus assembly protein ComGB	-
LE167_RS06590 (LE167_06620)	comGA	1390360..1391334 (-)	975	WP_002478129.1	competence type IV pilus ATPase ComGA	Machinery gene
LE167_RS06595 (LE167_06625)	-	1391381..1392004 (-)	624	WP_002459013.1	MBL fold metallo-hydrolase	-
LE167_RS06600 (LE167_06630)	-	1392008..1392331 (-)	324	WP_002459012.1	MTH1187 family thiamine-binding protein	-
LE167_RS06605 (LE167_06635)	-	1392331..1393317 (-)	987	WP_002478128.1	ROK family glucokinase	-
LE167_RS06610 (LE167_06640)	-	1393314..1393517 (-)	204	WP_002459010.1	YqgQ family protein	-

Sequence

Protein

• Length: 104 a.a.
• Molecular weight: 11373.37 Da
• Isoelectric Point: 8.2727

>NTDB_id=611344 LE167_RS06580 WP_002459016.1 1388995..1389309(-) (comGC) [Staphylococcus lugdunensis strain RMLUG5]
MKFSFYKKCKAFTLIEMLLVLLIISVLLILIIPNIAKQTAHVQSTGCEAQVKMVNSQIEAYTLKHNGSPKSIDDLISEGF
IKDGQKNCKSGETISISNGEAVAN

Nucleotide

• Length: 315 bp

>NTDB_id=611344 LE167_RS06580 WP_002459016.1 1388995..1389309(-) (comGC) [Staphylococcus lugdunensis strain RMLUG5]
ATGAAATTTTCTTTTTATAAAAAATGCAAAGCGTTTACACTAATAGAAATGTTATTAGTATTACTAATTATTAGTGTCTT
GCTTATCTTAATTATTCCAAACATTGCCAAACAAACAGCACATGTACAATCAACAGGTTGTGAAGCACAAGTAAAGATGG
TCAATAGCCAAATAGAAGCCTATACTCTAAAGCATAATGGATCTCCAAAAAGCATTGATGATTTAATTTCTGAGGGTTTT
ATTAAAGATGGTCAAAAGAATTGCAAATCTGGGGAAACCATCAGCATATCAAATGGTGAGGCAGTTGCAAATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (7-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	82.353	98.077	0.808
comGC	Staphylococcus aureus N315	82.353	98.077	0.808
comYC	Streptococcus gordonii str. Challis substr. CH1	45.918	94.231	0.433
comGC/cglC	Streptococcus pneumoniae TIGR4	44.554	97.115	0.433
comGC	Bacillus subtilis subsp. subtilis str. 168	46.154	87.5	0.404
comGC/cglC	Streptococcus pneumoniae R6	48.235	81.731	0.394
comGC/cglC	Streptococcus pneumoniae Rx1	48.235	81.731	0.394
comGC/cglC	Streptococcus pneumoniae D39	48.235	81.731	0.394
comGC	Lactococcus lactis subsp. cremoris KW2	50.633	75.962	0.385
comGC/cglC	Streptococcus mitis SK321	51.282	75	0.385
comGC/cglC	Streptococcus mitis NCTC 12261	51.282	75	0.385
comYC	Streptococcus mutans UA140	48.75	76.923	0.375
comYC	Streptococcus mutans UA159	48.75	76.923	0.375