NTDB

Overview

Name	comGC	Type	Machinery gene
Locus tag	LE164_RS09640	Genome accession	NZ_CP084440
Coordinates	2078581..2078895 (-)	Length	104 a.a.
NCBI ID	WP_002459016.1	Uniprot ID	-
Organism	Staphylococcus lugdunensis strain RMLUG4
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2073581..2083895

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LE164_RS09615 (LE164_09630)	gcvPA	2074154..2075503 (-)	1350	WP_002478134.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
LE164_RS09620 (LE164_09635)	gcvT	2075520..2076611 (-)	1092	WP_267262595.1	glycine cleavage system aminomethyltransferase GcvT	-
LE164_RS09625 (LE164_09640)	-	2076781..2077299 (-)	519	WP_002459021.1	shikimate kinase	-
LE164_RS09630 (LE164_09650)	-	2077874..2078167 (-)	294	WP_002478131.1	hypothetical protein	-
LE164_RS09635 (LE164_09655)	comGD	2078154..2078648 (-)	495	WP_225306455.1	competence type IV pilus minor pilin ComGD	-
LE164_RS09640 (LE164_09660)	comGC	2078581..2078895 (-)	315	WP_002459016.1	competence type IV pilus major pilin ComGC	Machinery gene
LE164_RS09645 (LE164_09665)	comGB	2078910..2079974 (-)	1065	WP_002478130.1	competence type IV pilus assembly protein ComGB	-
LE164_RS09650 (LE164_09670)	comGA	2079946..2080920 (-)	975	WP_002478129.1	competence type IV pilus ATPase ComGA	Machinery gene
LE164_RS09655 (LE164_09675)	-	2080967..2081590 (-)	624	WP_002459013.1	MBL fold metallo-hydrolase	-
LE164_RS09660 (LE164_09680)	-	2081594..2081917 (-)	324	WP_002459012.1	MTH1187 family thiamine-binding protein	-
LE164_RS09665 (LE164_09685)	-	2081917..2082903 (-)	987	WP_002478128.1	ROK family glucokinase	-
LE164_RS09670 (LE164_09690)	-	2082900..2083103 (-)	204	WP_002459010.1	YqgQ family protein	-

Sequence

Protein

Download Length: 104 a.a. Molecular weight: 11373.37 Da Isoelectric Point: 8.2727

                                >NTDB_id=611311 LE164_RS09640 WP_002459016.1 2078581..2078895(-) (comGC) [Staphylococcus lugdunensis strain RMLUG4]

MKFSFYKKCKAFTLIEMLLVLLIISVLLILIIPNIAKQTAHVQSTGCEAQVKMVNSQIEAYTLKHNGSPKSIDDLISEGF

IKDGQKNCKSGETISISNGEAVAN

Nucleotide

Download Length: 315 bp

                                >NTDB_id=611311 LE164_RS09640 WP_002459016.1 2078581..2078895(-) (comGC) [Staphylococcus lugdunensis strain RMLUG4]

ATGAAATTTTCTTTTTATAAAAAATGCAAAGCGTTTACACTAATAGAAATGTTATTAGTATTACTAATTATTAGTGTCTT

GCTTATCTTAATTATTCCAAACATTGCCAAACAAACAGCACATGTACAATCAACAGGTTGTGAAGCACAAGTAAAGATGG

TCAATAGCCAAATAGAAGCCTATACTCTAAAGCATAATGGATCTCCAAAAAGCATTGATGATTTAATTTCTGAGGGTTTT

ATTAAAGATGGTCAAAAGAATTGCAAATCTGGGGAAACCATCAGCATATCAAATGGTGAGGCAGTTGCAAATTAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(7-31)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGC	Staphylococcus aureus MW2	82.353	98.077	0.808
comGC	Staphylococcus aureus N315	82.353	98.077	0.808
comYC	Streptococcus gordonii str. Challis substr. CH1	45.918	94.231	0.433
comGC/cglC	Streptococcus pneumoniae TIGR4	44.554	97.115	0.433
comGC	Bacillus subtilis subsp. subtilis str. 168	46.154	87.5	0.404
comGC/cglC	Streptococcus pneumoniae R6	48.235	81.731	0.394
comGC/cglC	Streptococcus pneumoniae Rx1	48.235	81.731	0.394
comGC/cglC	Streptococcus pneumoniae D39	48.235	81.731	0.394
comGC	Lactococcus lactis subsp. cremoris KW2	50.633	75.962	0.385
comGC/cglC	Streptococcus mitis SK321	51.282	75	0.385
comGC/cglC	Streptococcus mitis NCTC 12261	51.282	75	0.385
comYC	Streptococcus mutans UA140	48.75	76.923	0.375
comYC	Streptococcus mutans UA159	48.75	76.923	0.375

Detailed information NTG0611311