Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | LE165_RS09495 | Genome accession | NZ_CP084434 |
| Coordinates | 2005302..2005727 (+) | Length | 141 a.a. |
| NCBI ID | WP_267263077.1 | Uniprot ID | - |
| Organism | Staphylococcus lugdunensis strain RMLUG2 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1999497..2041078 | 2005302..2005727 | within | 0 |
Gene organization within MGE regions
Location: 1999497..2041078
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LE165_RS09450 (LE165_09465) | - | 1999497..2000879 (-) | 1383 | WP_267263070.1 | recombinase family protein | - |
| LE165_RS09455 (LE165_09470) | - | 2000937..2001761 (-) | 825 | WP_267263071.1 | DUF5067 domain-containing protein | - |
| LE165_RS09460 (LE165_09475) | - | 2001761..2002240 (-) | 480 | WP_267263072.1 | ImmA/IrrE family metallo-endopeptidase | - |
| LE165_RS09465 (LE165_09480) | - | 2002254..2002574 (-) | 321 | WP_267263073.1 | helix-turn-helix transcriptional regulator | - |
| LE165_RS09470 (LE165_09485) | - | 2002738..2002983 (+) | 246 | WP_267263074.1 | helix-turn-helix transcriptional regulator | - |
| LE165_RS09475 (LE165_09490) | - | 2003003..2003707 (+) | 705 | WP_267263075.1 | Bro-N domain-containing protein | - |
| LE165_RS09480 (LE165_09495) | - | 2003897..2004076 (+) | 180 | WP_267263076.1 | hypothetical protein | - |
| LE165_RS09485 (LE165_09500) | - | 2004145..2004630 (+) | 486 | WP_241448634.1 | siphovirus Gp157 family protein | - |
| LE165_RS09490 (LE165_09505) | - | 2004631..2005305 (+) | 675 | WP_012991002.1 | ERF family protein | - |
| LE165_RS09495 (LE165_09510) | ssbA | 2005302..2005727 (+) | 426 | WP_267263077.1 | single-stranded DNA-binding protein | Machinery gene |
| LE165_RS09500 (LE165_09515) | - | 2005742..2006416 (+) | 675 | WP_267263078.1 | putative HNHc nuclease | - |
| LE165_RS09505 (LE165_09520) | - | 2006409..2007215 (+) | 807 | WP_267263079.1 | phage replisome organizer N-terminal domain-containing protein | - |
| LE165_RS09510 (LE165_09525) | - | 2007215..2007574 (+) | 360 | WP_267263080.1 | hypothetical protein | - |
| LE165_RS09515 (LE165_09530) | - | 2007567..2008802 (+) | 1236 | WP_267263081.1 | DnaB helicase C-terminal domain-containing protein | - |
| LE165_RS09520 (LE165_09535) | - | 2008799..2009026 (+) | 228 | WP_267263082.1 | hypothetical protein | - |
| LE165_RS09525 (LE165_09540) | - | 2009016..2009258 (+) | 243 | WP_062078553.1 | hypothetical protein | - |
| LE165_RS09530 (LE165_09545) | - | 2009267..2009674 (+) | 408 | WP_267263083.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LE165_RS09535 (LE165_09550) | - | 2009671..2009985 (+) | 315 | WP_014533256.1 | hypothetical protein | - |
| LE165_RS09540 (LE165_09555) | - | 2009988..2010239 (+) | 252 | WP_012990993.1 | hypothetical protein | - |
| LE165_RS09545 (LE165_09560) | - | 2010245..2010667 (+) | 423 | WP_267263084.1 | DUF3310 domain-containing protein | - |
| LE165_RS09550 (LE165_09565) | - | 2010671..2011069 (+) | 399 | WP_267263085.1 | hypothetical protein | - |
| LE165_RS09555 (LE165_09570) | - | 2011062..2011340 (+) | 279 | WP_267263086.1 | hypothetical protein | - |
| LE165_RS09560 (LE165_09575) | - | 2011503..2011739 (+) | 237 | WP_267263087.1 | hypothetical protein | - |
| LE165_RS09565 (LE165_09580) | - | 2011736..2011864 (+) | 129 | Protein_1840 | DUF1024 family protein | - |
| LE165_RS09570 (LE165_09585) | - | 2011884..2012204 (+) | 321 | WP_062078560.1 | MazG-like family protein | - |
| LE165_RS09575 (LE165_09590) | - | 2012304..2012627 (+) | 324 | WP_241448666.1 | DUF1523 family protein | - |
| LE165_RS09580 (LE165_09595) | - | 2012635..2012784 (+) | 150 | WP_241448645.1 | DUF1381 domain-containing protein | - |
| LE165_RS09585 (LE165_09600) | rinB | 2012777..2012959 (+) | 183 | WP_241448646.1 | transcriptional activator RinB | - |
| LE165_RS09590 (LE165_09605) | - | 2012956..2013105 (+) | 150 | WP_012990987.1 | hypothetical protein | - |
| LE165_RS09595 (LE165_09610) | - | 2013102..2013518 (+) | 417 | WP_012990986.1 | hypothetical protein | - |
| LE165_RS09600 (LE165_09615) | - | 2013821..2014240 (+) | 420 | WP_241448647.1 | helix-turn-helix domain-containing protein | - |
| LE165_RS09605 (LE165_09620) | - | 2014227..2015489 (+) | 1263 | WP_241448648.1 | PBSX family phage terminase large subunit | - |
| LE165_RS09610 (LE165_09625) | - | 2015490..2016926 (+) | 1437 | WP_267263088.1 | phage portal protein | - |
| LE165_RS09615 (LE165_09630) | - | 2016871..2017863 (+) | 993 | WP_267263089.1 | phage head morphogenesis protein | - |
| LE165_RS09620 (LE165_09635) | - | 2017960..2018556 (+) | 597 | WP_062078570.1 | phage scaffolding protein | - |
| LE165_RS09625 (LE165_09640) | - | 2018578..2019402 (+) | 825 | WP_267263090.1 | N4-gp56 family major capsid protein | - |
| LE165_RS09630 (LE165_09645) | - | 2019419..2019700 (+) | 282 | WP_150907584.1 | Rho termination factor N-terminal domain-containing protein | - |
| LE165_RS09635 (LE165_09650) | - | 2019700..2020011 (+) | 312 | WP_150907582.1 | phage head-tail connector protein | - |
| LE165_RS09640 (LE165_09655) | - | 2020004..2020339 (+) | 336 | WP_062078578.1 | phage head closure protein | - |
| LE165_RS09645 (LE165_09660) | - | 2020326..2020739 (+) | 414 | WP_150907580.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| LE165_RS09650 (LE165_09665) | - | 2020752..2021174 (+) | 423 | WP_062078582.1 | DUF3168 domain-containing protein | - |
| LE165_RS09655 (LE165_09670) | - | 2021178..2021723 (+) | 546 | WP_062078584.1 | hypothetical protein | - |
| LE165_RS09660 (LE165_09675) | - | 2021787..2022290 (+) | 504 | WP_267263091.1 | tail assembly chaperone | - |
| LE165_RS09665 (LE165_09680) | - | 2022338..2022625 (+) | 288 | WP_062078588.1 | hypothetical protein | - |
| LE165_RS09670 (LE165_09685) | - | 2022629..2025724 (+) | 3096 | WP_267263092.1 | terminase | - |
| LE165_RS09675 (LE165_09690) | - | 2025737..2026666 (+) | 930 | WP_150907576.1 | phage tail domain-containing protein | - |
| LE165_RS09680 (LE165_09695) | - | 2026678..2028534 (+) | 1857 | WP_150907575.1 | SGNH/GDSL hydrolase family protein | - |
| LE165_RS09685 (LE165_09700) | - | 2028546..2031206 (+) | 2661 | WP_267263093.1 | peptidase G2 autoproteolytic cleavage domain-containing protein | - |
| LE165_RS09690 (LE165_09705) | - | 2031206..2032735 (+) | 1530 | WP_267263094.1 | BppU family phage baseplate upper protein | - |
| LE165_RS09695 (LE165_09710) | - | 2032740..2033075 (+) | 336 | WP_062078600.1 | hypothetical protein | - |
| LE165_RS09700 (LE165_09715) | - | 2033077..2033220 (+) | 144 | WP_062078602.1 | XkdX family protein | - |
| LE165_RS09705 (LE165_09720) | - | 2033252..2033551 (+) | 300 | WP_062078604.1 | DUF2951 family protein | - |
| LE165_RS09710 (LE165_09725) | - | 2033689..2035569 (+) | 1881 | WP_267263095.1 | glucosaminidase domain-containing protein | - |
| LE165_RS09715 (LE165_09730) | - | 2035580..2038147 (+) | 2568 | WP_267263096.1 | BppU family phage baseplate upper protein | - |
| LE165_RS09720 (LE165_09735) | - | 2038204..2038638 (+) | 435 | WP_267263097.1 | phage holin | - |
| LE165_RS09725 (LE165_09740) | - | 2038638..2040074 (+) | 1437 | WP_267263098.1 | SH3 domain-containing protein | - |
| LE165_RS09730 (LE165_09745) | - | 2040231..2040473 (+) | 243 | WP_071561373.1 | hypothetical protein | - |
| LE165_RS12805 | - | 2040473..2040886 (+) | 414 | WP_410483037.1 | helix-turn-helix domain-containing protein | - |
| LE165_RS09740 (LE165_09755) | - | 2040941..2041078 (-) | 138 | Protein_1875 | FAD-binding protein | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15945.56 Da Isoelectric Point: 5.2281
>NTDB_id=611253 LE165_RS09495 WP_267263077.1 2005302..2005727(+) (ssbA) [Staphylococcus lugdunensis strain RMLUG2]
MINRVVLVGRLTKDPEFRTTPNGVSVATFTLAVNRTFTNAQGEREADFINVVVFRKQADNVNNYLNKGNLAGVDGRMQSR
SYENQEGKRVFVTEVVADSVQFLEPKNNKQSSNQPQQQNRQAQSDNNQFDNGLEEFSDLPF
MINRVVLVGRLTKDPEFRTTPNGVSVATFTLAVNRTFTNAQGEREADFINVVVFRKQADNVNNYLNKGNLAGVDGRMQSR
SYENQEGKRVFVTEVVADSVQFLEPKNNKQSSNQPQQQNRQAQSDNNQFDNGLEEFSDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=611253 LE165_RS09495 WP_267263077.1 2005302..2005727(+) (ssbA) [Staphylococcus lugdunensis strain RMLUG2]
ATGATAAATAGAGTTGTATTAGTAGGAAGATTAACAAAAGACCCAGAATTCAGAACAACGCCAAATGGTGTAAGTGTTGC
TACCTTTACACTAGCAGTAAATCGTACATTCACAAATGCACAAGGAGAACGTGAGGCAGATTTTATTAACGTTGTAGTGT
TTAGAAAACAAGCAGATAACGTCAATAACTATTTAAACAAAGGTAATTTAGCCGGTGTTGACGGAAGAATGCAATCGCGA
AGTTATGAAAACCAGGAAGGTAAAAGAGTGTTTGTTACAGAAGTAGTAGCAGATAGTGTTCAGTTTTTAGAACCTAAAAA
TAACAAACAATCAAGCAACCAACCACAACAACAAAATAGACAAGCGCAAAGTGATAACAACCAATTTGATAATGGTTTAG
AAGAATTTTCAGATCTTCCGTTTTGA
ATGATAAATAGAGTTGTATTAGTAGGAAGATTAACAAAAGACCCAGAATTCAGAACAACGCCAAATGGTGTAAGTGTTGC
TACCTTTACACTAGCAGTAAATCGTACATTCACAAATGCACAAGGAGAACGTGAGGCAGATTTTATTAACGTTGTAGTGT
TTAGAAAACAAGCAGATAACGTCAATAACTATTTAAACAAAGGTAATTTAGCCGGTGTTGACGGAAGAATGCAATCGCGA
AGTTATGAAAACCAGGAAGGTAAAAGAGTGTTTGTTACAGAAGTAGTAGCAGATAGTGTTCAGTTTTTAGAACCTAAAAA
TAACAAACAATCAAGCAACCAACCACAACAACAAAATAGACAAGCGCAAAGTGATAACAACCAATTTGATAATGGTTTAG
AAGAATTTTCAGATCTTCCGTTTTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
78.505 |
75.887 |
0.596 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
62.264 |
75.177 |
0.468 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
55.752 |
80.142 |
0.447 |
| ssbA | Streptococcus mutans UA159 |
41.844 |
100 |
0.418 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
41.844 |
100 |
0.418 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
39.716 |
100 |
0.397 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
39.716 |
100 |
0.397 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
39.007 |
100 |
0.39 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
39.007 |
100 |
0.39 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
39.007 |
100 |
0.39 |
| ssbB/cilA | Streptococcus mitis SK321 |
39.007 |
100 |
0.39 |