Detailed information NTG0611230

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: LE165_RS01395
• Genome accession: NZ_CP084434
• Coordinates: 303776..304090 (-)
• Length: 104 a.a.
• NCBI ID: WP_002459016.1
• Uniprot ID: -
• Organism: Staphylococcus lugdunensis strain RMLUG2
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 298776..309090

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LE165_RS01370 (LE165_01385)	gcvPA	299349..300698 (-)	1350	WP_002478134.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
LE165_RS01375 (LE165_01390)	gcvT	300715..301806 (-)	1092	WP_037544364.1	glycine cleavage system aminomethyltransferase GcvT	-
LE165_RS01380 (LE165_01395)	-	301976..302494 (-)	519	WP_002459021.1	shikimate kinase	-
LE165_RS12780 (LE165_01400)	-	302648..303106 (-)	459	WP_014533299.1	competence type IV pilus minor pilin ComGF	-
LE165_RS01385 (LE165_01405)	-	303069..303362 (-)	294	WP_002459018.1	hypothetical protein	-
LE165_RS01390 (LE165_01410)	comGD	303349..303843 (-)	495	WP_225306455.1	competence type IV pilus minor pilin ComGD	-
LE165_RS01395 (LE165_01415)	comGC	303776..304090 (-)	315	WP_002459016.1	competence type IV pilus major pilin ComGC	Machinery gene
LE165_RS01400 (LE165_01420)	comGB	304105..305169 (-)	1065	WP_252920573.1	competence type IV pilus assembly protein ComGB	-
LE165_RS01405 (LE165_01425)	comGA	305141..306115 (-)	975	WP_084951767.1	competence type IV pilus ATPase ComGA	Machinery gene
LE165_RS01410 (LE165_01430)	-	306162..306785 (-)	624	WP_084951765.1	MBL fold metallo-hydrolase	-
LE165_RS01415 (LE165_01435)	-	306789..307112 (-)	324	WP_084951763.1	MTH1187 family thiamine-binding protein	-
LE165_RS01420 (LE165_01440)	-	307112..308098 (-)	987	WP_084951762.1	ROK family glucokinase	-
LE165_RS01425 (LE165_01445)	-	308095..308298 (-)	204	WP_002459010.1	YqgQ family protein	-

Sequence

Protein

• Length: 104 a.a.
• Molecular weight: 11373.37 Da
• Isoelectric Point: 8.2727

>NTDB_id=611230 LE165_RS01395 WP_002459016.1 303776..304090(-) (comGC) [Staphylococcus lugdunensis strain RMLUG2]
MKFSFYKKCKAFTLIEMLLVLLIISVLLILIIPNIAKQTAHVQSTGCEAQVKMVNSQIEAYTLKHNGSPKSIDDLISEGF
IKDGQKNCKSGETISISNGEAVAN

Nucleotide

• Length: 315 bp

>NTDB_id=611230 LE165_RS01395 WP_002459016.1 303776..304090(-) (comGC) [Staphylococcus lugdunensis strain RMLUG2]
ATGAAATTTTCTTTTTATAAAAAATGCAAAGCGTTTACACTAATAGAAATGTTATTAGTATTACTAATTATTAGTGTCTT
GCTTATCTTAATTATTCCAAACATTGCCAAACAAACAGCACATGTACAATCAACAGGTTGTGAAGCACAAGTAAAGATGG
TCAATAGCCAAATAGAAGCCTATACTCTAAAGCATAATGGATCTCCAAAAAGCATTGATGATTTAATTTCTGAGGGTTTT
ATTAAAGATGGTCAAAAGAATTGCAAATCTGGGGAAACCATCAGCATATCAAATGGTGAGGCAGTTGCAAATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (7-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	82.353	98.077	0.808
comGC	Staphylococcus aureus N315	82.353	98.077	0.808
comYC	Streptococcus gordonii str. Challis substr. CH1	45.918	94.231	0.433
comGC/cglC	Streptococcus pneumoniae TIGR4	44.554	97.115	0.433
comGC	Bacillus subtilis subsp. subtilis str. 168	46.154	87.5	0.404
comGC/cglC	Streptococcus pneumoniae R6	48.235	81.731	0.394
comGC/cglC	Streptococcus pneumoniae Rx1	48.235	81.731	0.394
comGC/cglC	Streptococcus pneumoniae D39	48.235	81.731	0.394
comGC	Lactococcus lactis subsp. cremoris KW2	50.633	75.962	0.385
comGC/cglC	Streptococcus mitis SK321	51.282	75	0.385
comGC/cglC	Streptococcus mitis NCTC 12261	51.282	75	0.385
comYC	Streptococcus mutans UA140	48.75	76.923	0.375
comYC	Streptococcus mutans UA159	48.75	76.923	0.375