Detailed information
Overview
| Name | comC/comC2 | Type | Regulator |
| Locus tag | KX728_RS09255 | Genome accession | NZ_CP079724 |
| Coordinates | 1917156..1917281 (-) | Length | 41 a.a. |
| NCBI ID | WP_215804199.1 | Uniprot ID | - |
| Organism | Streptococcus oralis strain 34 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1912156..1922281
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KX728_RS09230 (KX728_09225) | - | 1914290..1914832 (+) | 543 | WP_215804202.1 | TetR/AcrR family transcriptional regulator | - |
| KX728_RS09245 (KX728_09240) | comE | 1915067..1915819 (-) | 753 | WP_215804201.1 | LytTR family DNA-binding domain-containing protein | Regulator |
| KX728_RS09250 (KX728_09245) | comD | 1915816..1917135 (-) | 1320 | WP_215804200.1 | GHKL domain-containing protein | Regulator |
| KX728_RS09255 (KX728_09250) | comC/comC2 | 1917156..1917281 (-) | 126 | WP_215804199.1 | competence-stimulating peptide ComC | Regulator |
| KX728_RS09265 (KX728_09260) | rlmH | 1917563..1918042 (-) | 480 | WP_000694219.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| KX728_RS09270 (KX728_09265) | htrA | 1918228..1919421 (+) | 1194 | WP_215804198.1 | S1C family serine protease | Regulator |
| KX728_RS09275 (KX728_09270) | spo0J | 1919479..1920237 (+) | 759 | WP_125413781.1 | ParB/RepB/Spo0J family partition protein | Regulator |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 5020.74 Da Isoelectric Point: 8.8368
>NTDB_id=589012 KX728_RS09255 WP_215804199.1 1917156..1917281(-) (comC/comC2) [Streptococcus oralis strain 34]
MKNTEKLEQFKEVTETELQEIRGGDWRISETIRNLIFPRRK
MKNTEKLEQFKEVTETELQEIRGGDWRISETIRNLIFPRRK
Nucleotide
Download Length: 126 bp
>NTDB_id=589012 KX728_RS09255 WP_215804199.1 1917156..1917281(-) (comC/comC2) [Streptococcus oralis strain 34]
ATGAAAAATACAGAAAAGTTGGAACAATTTAAAGAAGTAACAGAGACAGAATTGCAGGAGATTCGAGGTGGAGATTGGAG
AATTTCAGAAACAATTCGTAATCTTATTTTTCCAAGAAGAAAGTAA
ATGAAAAATACAGAAAAGTTGGAACAATTTAAAGAAGTAACAGAGACAGAATTGCAGGAGATTCGAGGTGGAGATTGGAG
AATTTCAGAAACAATTCGTAATCTTATTTTTCCAAGAAGAAAGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC2 | Streptococcus pneumoniae A66 |
53.659 |
100 |
0.537 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
53.659 |
100 |
0.537 |
| comC | Streptococcus mitis SK321 |
53.659 |
100 |
0.537 |
| comC/comC1 | Streptococcus pneumoniae R6 |
51.22 |
100 |
0.512 |
| comC/comC1 | Streptococcus pneumoniae G54 |
51.22 |
100 |
0.512 |
| comC/comC1 | Streptococcus pneumoniae D39 |
51.22 |
100 |
0.512 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
51.22 |
100 |
0.512 |
| comC | Streptococcus mitis NCTC 12261 |
45 |
97.561 |
0.439 |
| comC/comC2 | Streptococcus gordonii strain NCTC7865 |
43.243 |
90.244 |
0.39 |
| comC/comC1 | Streptococcus gordonii str. Challis substr. CH1 |
39.474 |
92.683 |
0.366 |