Detailed information NTG0587475

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: KW861_RS01125
• Genome accession: NZ_CP078505
• Coordinates: 217144..217419 (+)
• Length: 91 a.a.
• NCBI ID: WP_103300292.1
• Uniprot ID: -
• Organism: Enterococcus gallinarum strain fecal_iso1
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 212144..222419

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
KW861_RS01100 (KW861_01095)	-	212277..213488 (+)	1212	WP_103300290.1	ABC transporter permease	-
KW861_RS01105 (KW861_01100)	-	213593..214372 (+)	780	WP_003128432.1	phosphotransferase family protein	-
KW861_RS01110 (KW861_01105)	trmB	214426..215088 (+)	663	WP_103300411.1	tRNA (guanosine(46)-N7)-methyltransferase TrmB	-
KW861_RS01115 (KW861_01110)	comGA	215200..216141 (+)	942	WP_005472888.1	competence type IV pilus ATPase ComGA	-
KW861_RS01120 (KW861_01115)	comGB	216116..217147 (+)	1032	WP_103300291.1	competence type IV pilus assembly protein ComGB	-
KW861_RS01125 (KW861_01120)	comYC	217144..217419 (+)	276	WP_103300292.1	competence type IV pilus major pilin ComGC	Machinery gene
KW861_RS01130 (KW861_01125)	comGD	217388..217867 (+)	480	WP_103300293.1	competence type IV pilus minor pilin ComGD	-
KW861_RS01135 (KW861_01130)	-	217878..218159 (+)	282	WP_103300412.1	hypothetical protein	-
KW861_RS01140 (KW861_01135)	comGF	218149..218562 (+)	414	WP_003128440.1	competence type IV pilus minor pilin ComGF	-
KW861_RS01145 (KW861_01140)	comGG	218537..218890 (+)	354	WP_103300294.1	competence type IV pilus minor pilin ComGG	-
KW861_RS01150 (KW861_01145)	-	219065..220072 (+)	1008	WP_003128442.1	class I SAM-dependent methyltransferase	-
KW861_RS01155 (KW861_01150)	-	220097..221281 (+)	1185	WP_003128443.1	acetate/propionate family kinase	-
KW861_RS01160 (KW861_01155)	-	221503..221814 (-)	312	WP_081131434.1	DUF1048 domain-containing protein	-
KW861_RS01165 (KW861_01160)	-	221824..222165 (-)	342	WP_081131433.1	DUF1048 domain-containing protein	-

Sequence

Protein

• Length: 91 a.a.
• Molecular weight: 10450.23 Da
• Isoelectric Point: 6.4633

>NTDB_id=587475 KW861_RS01125 WP_103300292.1 217144..217419(+) (comYC) [Enterococcus gallinarum strain fecal_iso1]
MRKLKHQGFTLVEMLIVLLVISILILLFVPNLSAQRTVIDEKGNAAIVKVVESQIELFQLNENRTPTRQELLAGNYVTEE
QYAIYLAHRNE

Nucleotide

• Length: 276 bp

>NTDB_id=587475 KW861_RS01125 WP_103300292.1 217144..217419(+) (comYC) [Enterococcus gallinarum strain fecal_iso1]
ATGAGAAAATTGAAGCATCAGGGGTTCACATTGGTGGAGATGCTGATTGTACTGTTAGTGATCAGTATTTTGATTTTATT
GTTTGTACCAAACTTATCTGCACAACGTACAGTGATAGATGAGAAAGGAAATGCGGCAATCGTCAAAGTCGTAGAATCCC
AGATTGAGTTGTTCCAGCTTAATGAGAATCGAACACCTACTCGACAAGAATTACTAGCTGGAAATTATGTAACGGAGGAG
CAGTATGCGATTTATCTTGCCCATCGGAACGAATAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-27)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus suis isolate S10	52.688	100	0.538
comGC/cglC	Streptococcus mitis NCTC 12261	51.613	100	0.527
comYC	Streptococcus mutans UA159	49.462	100	0.505
comYC	Streptococcus mutans UA140	49.462	100	0.505
comGC/cglC	Streptococcus pneumoniae TIGR4	49.451	100	0.495
comGC/cglC	Streptococcus pneumoniae Rx1	49.451	100	0.495
comGC/cglC	Streptococcus pneumoniae D39	49.451	100	0.495
comGC/cglC	Streptococcus pneumoniae R6	49.451	100	0.495
comGC/cglC	Streptococcus mitis SK321	52.941	93.407	0.495
comGC	Lactococcus lactis subsp. cremoris KW2	51.136	96.703	0.495
comYC	Streptococcus gordonii str. Challis substr. CH1	49.438	97.802	0.484
comGC	Staphylococcus aureus MW2	46.154	85.714	0.396
comGC	Staphylococcus aureus N315	46.154	85.714	0.396