Detailed information NTG0577955

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: MTO79_RS12395
• Genome accession: NZ_CP094474
• Coordinates: 2423499..2423768 (-)
• Length: 89 a.a.
• NCBI ID: WP_003129998.1
• Uniprot ID: -
• Organism: Lactococcus lactis strain SCB469
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2418499..2428768

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
MTO79_RS12355 (MTO79_12355)	-	2418755..2419492 (-)	738	WP_058221575.1	metal ABC transporter ATP-binding protein	-
MTO79_RS12360 (MTO79_12360)	-	2419669..2420511 (-)	843	WP_003129990.1	metal ABC transporter substrate-binding protein	-
MTO79_RS12365 (MTO79_12365)	-	2420508..2420945 (-)	438	WP_003129992.1	zinc-dependent MarR family transcriptional regulator	-
MTO79_RS12370 (MTO79_12370)	-	2421152..2422099 (+)	948	WP_003130410.1	IS30 family transposase	-
MTO79_RS12375 (MTO79_12375)	comGG	2422073..2422399 (-)	327	WP_058221568.1	competence type IV pilus minor pilin ComGG	Machinery gene
MTO79_RS12380 (MTO79_12380)	comGF	2422449..2422877 (-)	429	Protein_2393	competence type IV pilus minor pilin ComGF	-
MTO79_RS12385 (MTO79_12385)	comGE	2422840..2423136 (-)	297	WP_010906316.1	competence type IV pilus minor pilin ComGE	Machinery gene
MTO79_RS12390 (MTO79_12390)	comGD	2423108..2423539 (-)	432	WP_080585155.1	competence type IV pilus minor pilin ComGD	Machinery gene
MTO79_RS12395 (MTO79_12395)	comGC	2423499..2423768 (-)	270	WP_003129998.1	competence type IV pilus major pilin ComGC	Machinery gene
MTO79_RS12400 (MTO79_12400)	-	2423895..2424587 (-)	693	WP_152994386.1	hypothetical protein	-
MTO79_RS12405 (MTO79_12405)	-	2424829..2425608 (-)	780	WP_082225220.1	peptidoglycan amidohydrolase family protein	-
MTO79_RS12410 (MTO79_12410)	-	2425608..2425907 (-)	300	WP_031559226.1	phage holin	-
MTO79_RS12415 (MTO79_12415)	-	2425920..2426270 (-)	351	WP_014570798.1	hypothetical protein	-
MTO79_RS12420 (MTO79_12420)	-	2426283..2426519 (-)	237	WP_082225257.1	hypothetical protein	-

Sequence

Protein

• Length: 89 a.a.
• Molecular weight: 10123.56 Da
• Isoelectric Point: 4.2950

>NTDB_id=577955 MTO79_RS12395 WP_003129998.1 2423499..2423768(-) (comGC) [Lactococcus lactis strain SCB469]
MLIVLAIISILILLFVPNLIKEKSQVQKTGEAAVVKVVESQAQLYELDHDDEKPSLPELLSAGMITQKQISAYDNYYDQN
KNEERNFND

Nucleotide

• Length: 270 bp

>NTDB_id=577955 MTO79_RS12395 WP_003129998.1 2423499..2423768(-) (comGC) [Lactococcus lactis strain SCB469]
ATGTTAATTGTACTAGCTATTATTAGTATTTTAATATTACTATTTGTTCCAAATTTAATTAAAGAAAAATCACAAGTTCA
AAAAACTGGAGAAGCGGCAGTTGTAAAAGTAGTAGAAAGTCAAGCTCAACTTTATGAATTAGATCATGATGATGAGAAGC
CGAGTCTGCCAGAATTGCTCAGCGCTGGGATGATTACTCAAAAACAAATTTCTGCTTACGATAATTACTATGATCAGAAC
AAAAATGAAGAACGAAATTTTAATGACTAG

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Lactococcus lactis subsp. cremoris KW2	86.667	84.27	0.73
comGC/cglC	Streptococcus pneumoniae Rx1	55.056	100	0.551
comGC/cglC	Streptococcus pneumoniae D39	55.056	100	0.551
comGC/cglC	Streptococcus pneumoniae R6	55.056	100	0.551
comGC/cglC	Streptococcus pneumoniae TIGR4	55.056	100	0.551
comGC	Streptococcus gordonii str. Challis substr. CH1	56.471	95.506	0.539
comGC	Streptococcus suis isolate S10	58.904	82.022	0.483
comGC/cglC	Streptococcus mitis SK321	53.947	85.393	0.461
comGC	Streptococcus mutans UA140	50.685	82.022	0.416
comGC	Streptococcus mutans UA159	50.685	82.022	0.416
comGC/cglC	Streptococcus mitis NCTC 12261	56.25	71.91	0.404