Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | SAI5S5_RS10095 | Genome accession | NC_020566 |
| Coordinates | 2018306..2018731 (-) | Length | 141 a.a. |
| NCBI ID | WP_000934384.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus subsp. aureus ST228 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1984860..2024391 | 2018306..2018731 | within | 0 |
Gene organization within MGE regions
Location: 1984860..2024391
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SAI5S5_RS09850 | scn | 1984860..1985210 (-) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| SAI5S5_RS09855 | - | 1985721..1986059 (-) | 339 | Protein_1860 | SH3 domain-containing protein | - |
| SAI5S5_RS09860 (SAI5S5_1014660) | sak | 1986707..1987198 (-) | 492 | WP_000920038.1 | staphylokinase | - |
| SAI5S5_RS09865 (SAI5S5_1014670) | - | 1987389..1988144 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| SAI5S5_RS09870 | - | 1988156..1988410 (-) | 255 | WP_000611512.1 | phage holin | - |
| SAI5S5_RS09875 | - | 1988462..1988569 (+) | 108 | WP_031762631.1 | hypothetical protein | - |
| SAI5S5_RS14590 | pepG1 | 1988622..1988756 (-) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| SAI5S5_RS09885 (SAI5S5_1014680) | sea | 1988907..1989680 (-) | 774 | WP_000750412.1 | staphylococcal enterotoxin type A | - |
| SAI5S5_RS09890 | - | 1990053..1990427 (-) | 375 | WP_000340977.1 | hypothetical protein | - |
| SAI5S5_RS09895 | - | 1990483..1990770 (-) | 288 | WP_001262621.1 | hypothetical protein | - |
| SAI5S5_RS09900 | - | 1990816..1990968 (-) | 153 | WP_001000058.1 | hypothetical protein | - |
| SAI5S5_RS09905 (SAI5S5_1014690) | - | 1990961..1994743 (-) | 3783 | WP_015445885.1 | phage tail spike protein | - |
| SAI5S5_RS09910 (SAI5S5_1014700) | - | 1994759..1996243 (-) | 1485 | WP_000567390.1 | phage distal tail protein | - |
| SAI5S5_RS09915 (SAI5S5_1014710) | - | 1996240..2000769 (-) | 4530 | WP_015445887.1 | phage tail tape measure protein | - |
| SAI5S5_RS15155 | gpGT | 2000826..2000963 (-) | 138 | WP_001549167.1 | phage tail assembly chaperone GT | - |
| SAI5S5_RS09925 | gpG | 2001014..2001364 (-) | 351 | WP_001096355.1 | phage tail assembly chaperone G | - |
| SAI5S5_RS14595 | - | 2001414..2001638 (-) | 225 | WP_072050172.1 | Ig-like domain-containing protein | - |
| SAI5S5_RS09930 (SAI5S5_1014720) | - | 2001680..2002324 (-) | 645 | WP_000268741.1 | major tail protein | - |
| SAI5S5_RS09935 | - | 2002325..2002732 (-) | 408 | WP_000565498.1 | hypothetical protein | - |
| SAI5S5_RS09940 | - | 2002729..2003133 (-) | 405 | WP_000114225.1 | HK97 gp10 family phage protein | - |
| SAI5S5_RS09945 | - | 2003130..2003492 (-) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| SAI5S5_RS09950 | - | 2003476..2003760 (-) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| SAI5S5_RS09955 | - | 2003750..2004034 (-) | 285 | WP_000238236.1 | hypothetical protein | - |
| SAI5S5_RS09960 (SAI5S5_1014730) | - | 2004054..2005199 (-) | 1146 | WP_000154555.1 | phage major capsid protein | - |
| SAI5S5_RS09965 (SAI5S5_1014740) | - | 2005223..2005960 (-) | 738 | WP_000861914.1 | head maturation protease, ClpP-related | - |
| SAI5S5_RS09970 (SAI5S5_1014750) | - | 2005944..2007131 (-) | 1188 | WP_000025274.1 | phage portal protein | - |
| SAI5S5_RS09975 (SAI5S5_1014760) | - | 2007147..2008808 (-) | 1662 | WP_015445889.1 | terminase large subunit | - |
| SAI5S5_RS09980 | - | 2008805..2009149 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| SAI5S5_RS09985 | - | 2009279..2009578 (-) | 300 | WP_000988336.1 | HNH endonuclease | - |
| SAI5S5_RS09990 | - | 2009810..2010226 (-) | 417 | WP_000590126.1 | hypothetical protein | - |
| SAI5S5_RS09995 | - | 2010254..2010454 (-) | 201 | WP_000265041.1 | DUF1514 family protein | - |
| SAI5S5_RS10000 | rinB | 2010454..2010603 (-) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| SAI5S5_RS10005 | - | 2010600..2010806 (-) | 207 | WP_000195820.1 | DUF1381 domain-containing protein | - |
| SAI5S5_RS10010 (SAI5S5_1014770) | - | 2010843..2011379 (-) | 537 | WP_000185680.1 | dUTPase | - |
| SAI5S5_RS10015 | - | 2011372..2011620 (-) | 249 | WP_041174218.1 | DUF1024 family protein | - |
| SAI5S5_RS10020 | - | 2011613..2011921 (-) | 309 | WP_001614813.1 | hypothetical protein | - |
| SAI5S5_RS10025 | - | 2011918..2012265 (-) | 348 | WP_000979209.1 | YopX family protein | - |
| SAI5S5_RS10030 | - | 2012262..2012663 (-) | 402 | WP_000695762.1 | hypothetical protein | - |
| SAI5S5_RS10035 | - | 2012676..2012924 (-) | 249 | WP_012068339.1 | SAV1978 family virulence-associated passenger protein | - |
| SAI5S5_RS10040 | - | 2012924..2013178 (-) | 255 | WP_000022735.1 | DUF3310 domain-containing protein | - |
| SAI5S5_RS10045 | - | 2013264..2013449 (-) | 186 | WP_001187230.1 | DUF3113 family protein | - |
| SAI5S5_RS10050 | - | 2013454..2013858 (-) | 405 | WP_031895320.1 | DUF1064 domain-containing protein | - |
| SAI5S5_RS10055 | - | 2013855..2014280 (-) | 426 | WP_000451861.1 | phage N-6-adenine-methyltransferase | - |
| SAI5S5_RS10060 | - | 2014290..2014511 (-) | 222 | WP_001123688.1 | DUF3269 family protein | - |
| SAI5S5_RS10065 | - | 2014515..2014730 (-) | 216 | WP_001024405.1 | hypothetical protein | - |
| SAI5S5_RS10070 (SAI5S5_1014780) | - | 2014727..2015968 (-) | 1242 | WP_015445891.1 | DnaB helicase C-terminal domain-containing protein | - |
| SAI5S5_RS10075 | - | 2015965..2016321 (-) | 357 | WP_001132243.1 | hypothetical protein | - |
| SAI5S5_RS10080 (SAI5S5_1014790) | - | 2016321..2017076 (-) | 756 | WP_001037657.1 | DnaD domain protein | - |
| SAI5S5_RS10085 (SAI5S5_1014800) | - | 2017069..2017743 (-) | 675 | WP_015445893.1 | putative HNHc nuclease | - |
| SAI5S5_RS10090 (SAI5S5_1014810) | - | 2017744..2018295 (-) | 552 | WP_001004506.1 | NUMOD4 domain-containing protein | - |
| SAI5S5_RS10095 | ssbA | 2018306..2018731 (-) | 426 | WP_000934384.1 | single-stranded DNA-binding protein | Machinery gene |
| SAI5S5_RS10100 (SAI5S5_1014820) | - | 2018731..2019354 (-) | 624 | WP_000139720.1 | DUF1071 domain-containing protein | - |
| SAI5S5_RS10105 | - | 2019347..2019568 (-) | 222 | WP_000815403.1 | DUF2483 family protein | - |
| SAI5S5_RS10110 | - | 2019578..2019838 (-) | 261 | WP_000291076.1 | DUF1108 family protein | - |
| SAI5S5_RS10115 | - | 2019930..2020091 (-) | 162 | WP_000066021.1 | DUF1270 family protein | - |
| SAI5S5_RS10120 | - | 2020103..2020366 (-) | 264 | WP_001124198.1 | helix-turn-helix domain-containing protein | - |
| SAI5S5_RS15100 | - | 2020515..2020614 (-) | 100 | Protein_1915 | hypothetical protein | - |
| SAI5S5_RS10130 | - | 2020611..2020937 (-) | 327 | WP_001025595.1 | hypothetical protein | - |
| SAI5S5_RS10135 (SAI5S5_1014830) | - | 2020993..2021625 (+) | 633 | WP_001814660.1 | hypothetical protein | - |
| SAI5S5_RS10140 | - | 2021640..2021780 (-) | 141 | WP_000939500.1 | hypothetical protein | - |
| SAI5S5_RS10145 (SAI5S5_1014840) | groL | 2022415..2024031 (-) | 1617 | WP_000240642.1 | chaperonin GroEL | - |
| SAI5S5_RS10150 | groES | 2024107..2024391 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15784.48 Da Isoelectric Point: 8.4826
>NTDB_id=57274 SAI5S5_RS10095 WP_000934384.1 2018306..2018731(-) (ssbA) [Staphylococcus aureus subsp. aureus ST228]
MLNRAVLVGRLTKDPELRSAPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNNADSIEDLPF
MLNRAVLVGRLTKDPELRSAPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNNADSIEDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=57274 SAI5S5_RS10095 WP_000934384.1 2018306..2018731(-) (ssbA) [Staphylococcus aureus subsp. aureus ST228]
ATGTTAAACAGAGCAGTATTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCGCGCCAAATGGCGTAAATGTAGG
TACATTCACATTGGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAGAAACAAGCTGAAAATGTTAAAAACTACCTTTCTAAAGGGTCGCTGGCAGGTGTAGACGGGCGATTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAACAACGCAG
ACTCTATAGAGGATCTTCCTTTTTAG
ATGTTAAACAGAGCAGTATTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCGCGCCAAATGGCGTAAATGTAGG
TACATTCACATTGGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAGAAACAAGCTGAAAATGTTAAAAACTACCTTTCTAAAGGGTCGCTGGCAGGTGTAGACGGGCGATTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAACAACGCAG
ACTCTATAGAGGATCTTCCTTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
73.729 |
83.688 |
0.617 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50 |
100 |
0.603 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
75.177 |
0.44 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
41.844 |
100 |
0.418 |
| ssbA | Streptococcus mutans UA159 |
46.087 |
81.56 |
0.376 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
44.915 |
83.688 |
0.376 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
44.915 |
83.688 |
0.376 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
44.068 |
83.688 |
0.369 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
44.068 |
83.688 |
0.369 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
44.068 |
83.688 |
0.369 |
| ssbB/cilA | Streptococcus mitis SK321 |
44.068 |
83.688 |
0.369 |