Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | KI239_RS04400 | Genome accession | NZ_CP076028 |
| Coordinates | 910962..911390 (+) | Length | 142 a.a. |
| NCBI ID | WP_000934385.1 | Uniprot ID | A0A2K0CLZ8 |
| Organism | Staphylococcus sp. MZ8 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 902190..945745 | 910962..911390 | within | 0 |
Gene organization within MGE regions
Location: 902190..945745
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KI239_RS04320 (KI239_04320) | sufB | 902190..903587 (+) | 1398 | WP_001074405.1 | Fe-S cluster assembly protein SufB | - |
| KI239_RS04325 (KI239_04325) | - | 903655..904704 (-) | 1050 | WP_214982221.1 | tyrosine-type recombinase/integrase | - |
| KI239_RS04330 (KI239_04330) | - | 904901..905605 (-) | 705 | WP_017804779.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| KI239_RS04335 (KI239_04335) | - | 905637..906362 (-) | 726 | WP_000661437.1 | PH domain-containing protein | - |
| KI239_RS04340 (KI239_04340) | - | 906390..907064 (-) | 675 | WP_000775187.1 | ImmA/IrrE family metallo-endopeptidase | - |
| KI239_RS04345 (KI239_04345) | - | 907081..907413 (-) | 333 | WP_001055143.1 | helix-turn-helix transcriptional regulator | - |
| KI239_RS04350 (KI239_04350) | - | 907676..907870 (+) | 195 | WP_000108122.1 | helix-turn-helix transcriptional regulator | - |
| KI239_RS04355 (KI239_04355) | - | 907870..908640 (+) | 771 | WP_214982225.1 | phage antirepressor KilAC domain-containing protein | - |
| KI239_RS04360 (KI239_04360) | - | 908637..908861 (+) | 225 | WP_000187184.1 | hypothetical protein | - |
| KI239_RS04365 (KI239_04365) | - | 908901..909104 (+) | 204 | Protein_857 | hypothetical protein | - |
| KI239_RS04370 (KI239_04370) | - | 909072..909317 (-) | 246 | WP_000122246.1 | hypothetical protein | - |
| KI239_RS04375 (KI239_04375) | - | 909388..909609 (+) | 222 | WP_000977378.1 | hypothetical protein | - |
| KI239_RS04380 (KI239_04380) | - | 909602..909763 (+) | 162 | WP_000066017.1 | DUF1270 domain-containing protein | - |
| KI239_RS04385 (KI239_04385) | - | 909855..910115 (+) | 261 | WP_000291090.1 | DUF1108 family protein | - |
| KI239_RS04390 (KI239_04390) | - | 910125..910346 (+) | 222 | WP_000815401.1 | DUF2483 family protein | - |
| KI239_RS04395 (KI239_04395) | - | 910339..910962 (+) | 624 | WP_000139720.1 | DUF1071 domain-containing protein | - |
| KI239_RS04400 (KI239_04400) | ssbA | 910962..911390 (+) | 429 | WP_000934385.1 | single-stranded DNA-binding protein | Machinery gene |
| KI239_RS04405 (KI239_04405) | - | 911404..912078 (+) | 675 | WP_001124439.1 | putative HNHc nuclease | - |
| KI239_RS04410 (KI239_04410) | - | 912075..912224 (+) | 150 | WP_001081076.1 | hypothetical protein | - |
| KI239_RS04415 (KI239_04415) | - | 912217..912498 (-) | 282 | WP_000414755.1 | hypothetical protein | - |
| KI239_RS04420 (KI239_04420) | - | 912564..913334 (+) | 771 | WP_000190253.1 | conserved phage C-terminal domain-containing protein | - |
| KI239_RS04425 (KI239_04425) | - | 913344..914123 (+) | 780 | WP_000803062.1 | ATP-binding protein | - |
| KI239_RS04430 (KI239_04430) | - | 914117..914275 (+) | 159 | WP_000256590.1 | hypothetical protein | - |
| KI239_RS04435 (KI239_04435) | - | 914288..914509 (+) | 222 | WP_001123685.1 | DUF3269 family protein | - |
| KI239_RS04440 (KI239_04440) | - | 914520..914924 (+) | 405 | WP_000049810.1 | DUF1064 domain-containing protein | - |
| KI239_RS04445 (KI239_04445) | - | 914929..915114 (+) | 186 | WP_049317452.1 | DUF3113 family protein | - |
| KI239_RS04450 (KI239_04450) | - | 915115..915471 (+) | 357 | WP_000029369.1 | SA1788 family PVL leukocidin-associated protein | - |
| KI239_RS04455 (KI239_04455) | - | 915475..915717 (+) | 243 | WP_000131381.1 | phi PVL orf 51-like protein | - |
| KI239_RS04460 (KI239_04460) | - | 915732..915983 (+) | 252 | WP_025174939.1 | DUF1024 family protein | - |
| KI239_RS04465 (KI239_04465) | - | 915973..916146 (+) | 174 | WP_000028424.1 | hypothetical protein | - |
| KI239_RS04470 (KI239_04470) | - | 916147..916428 (+) | 282 | WP_000454994.1 | hypothetical protein | - |
| KI239_RS04475 (KI239_04475) | - | 916429..916590 (+) | 162 | WP_000889683.1 | hypothetical protein | - |
| KI239_RS04480 (KI239_04480) | - | 916605..917138 (+) | 534 | WP_025920701.1 | dUTP diphosphatase | - |
| KI239_RS04485 (KI239_04485) | - | 917175..917381 (+) | 207 | WP_000195827.1 | DUF1381 domain-containing protein | - |
| KI239_RS04490 (KI239_04490) | - | 917378..917572 (+) | 195 | Protein_882 | hypothetical protein | - |
| KI239_RS04495 (KI239_04495) | - | 917569..917772 (+) | 204 | WP_001072795.1 | hypothetical protein | - |
| KI239_RS04500 (KI239_04500) | - | 917765..918001 (+) | 237 | WP_000608278.1 | hypothetical protein | - |
| KI239_RS04505 (KI239_04505) | - | 917994..918167 (+) | 174 | WP_000595257.1 | transcriptional activator RinB | - |
| KI239_RS04510 (KI239_04510) | - | 918168..918314 (+) | 147 | WP_000990005.1 | hypothetical protein | - |
| KI239_RS04515 (KI239_04515) | - | 918338..918760 (+) | 423 | WP_000162701.1 | RinA family phage transcriptional activator | - |
| KI239_RS04520 (KI239_04520) | - | 918948..919442 (+) | 495 | WP_001038244.1 | terminase small subunit | - |
| KI239_RS04525 (KI239_04525) | - | 919445..920740 (+) | 1296 | WP_117172029.1 | PBSX family phage terminase large subunit | - |
| KI239_RS04530 (KI239_04530) | - | 920751..922289 (+) | 1539 | WP_214958327.1 | phage portal protein | - |
| KI239_RS04535 (KI239_04535) | - | 922296..923291 (+) | 996 | WP_001133041.1 | minor capsid protein | - |
| KI239_RS04540 (KI239_04540) | - | 923364..923534 (+) | 171 | WP_061732709.1 | hypothetical protein | - |
| KI239_RS04545 (KI239_04545) | - | 923669..924283 (+) | 615 | WP_000354305.1 | DUF4355 domain-containing protein | - |
| KI239_RS04550 (KI239_04550) | - | 924297..925271 (+) | 975 | WP_000438511.1 | phage major capsid protein | - |
| KI239_RS04555 (KI239_04555) | - | 925293..925580 (+) | 288 | WP_214958328.1 | hypothetical protein | - |
| KI239_RS04560 (KI239_04560) | - | 925589..925921 (+) | 333 | WP_214958329.1 | phage head-tail connector protein | - |
| KI239_RS04565 (KI239_04565) | - | 925918..926220 (+) | 303 | WP_001268312.1 | hypothetical protein | - |
| KI239_RS04570 (KI239_04570) | - | 926220..926567 (+) | 348 | WP_001017815.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| KI239_RS04575 (KI239_04575) | - | 926579..926962 (+) | 384 | WP_000188642.1 | hypothetical protein | - |
| KI239_RS04580 (KI239_04580) | - | 926981..927562 (+) | 582 | WP_214982228.1 | phage major tail protein, TP901-1 family | - |
| KI239_RS04585 (KI239_04585) | - | 927624..927989 (+) | 366 | WP_001100161.1 | tail assembly chaperone | - |
| KI239_RS04590 (KI239_04590) | - | 928019..928363 (+) | 345 | WP_000105584.1 | hypothetical protein | - |
| KI239_RS04595 (KI239_04595) | - | 928380..931847 (+) | 3468 | WP_072472461.1 | hypothetical protein | - |
| KI239_RS04600 (KI239_04600) | - | 931860..932807 (+) | 948 | WP_000350675.1 | phage tail family protein | - |
| KI239_RS04605 (KI239_04605) | - | 932816..934714 (+) | 1899 | WP_000152718.1 | SGNH/GDSL hydrolase family protein | - |
| KI239_RS04610 (KI239_04610) | - | 934729..936639 (+) | 1911 | WP_031928995.1 | hypothetical protein | - |
| KI239_RS04615 (KI239_04615) | - | 936639..938462 (+) | 1824 | WP_072472460.1 | phage baseplate upper protein | - |
| KI239_RS04620 (KI239_04620) | - | 938462..938839 (+) | 378 | WP_000705914.1 | DUF2977 domain-containing protein | - |
| KI239_RS04625 (KI239_04625) | - | 938849..939022 (+) | 174 | WP_001790193.1 | XkdX family protein | - |
| KI239_RS04630 (KI239_04630) | - | 939062..939361 (+) | 300 | WP_000466777.1 | DUF2951 domain-containing protein | - |
| KI239_RS04635 (KI239_04635) | - | 939498..941396 (+) | 1899 | WP_214958330.1 | glucosaminidase domain-containing protein | - |
| KI239_RS04640 (KI239_04640) | - | 941409..942647 (+) | 1239 | WP_069990338.1 | BppU family phage baseplate upper protein | - |
| KI239_RS04645 (KI239_04645) | - | 942653..943048 (+) | 396 | WP_000398874.1 | hypothetical protein | - |
| KI239_RS04650 (KI239_04650) | - | 943104..943379 (+) | 276 | WP_000351121.1 | phage holin | - |
| KI239_RS04655 (KI239_04655) | - | 943366..944778 (+) | 1413 | WP_001141515.1 | N-acetylmuramoyl-L-alanine amidase | - |
| KI239_RS04660 (KI239_04660) | eta | 944903..945745 (+) | 843 | WP_001065781.1 | exfoliative toxin A | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 15872.58 Da Isoelectric Point: 8.4825
>NTDB_id=571494 KI239_RS04400 WP_000934385.1 910962..911390(+) (ssbA) [Staphylococcus sp. MZ8]
MLNRAVLVGRLTKDPELRSAPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
MLNRAVLVGRLTKDPELRSAPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
Nucleotide
Download Length: 429 bp
>NTDB_id=571494 KI239_RS04400 WP_000934385.1 910962..911390(+) (ssbA) [Staphylococcus sp. MZ8]
ATGTTAAACAGAGCAGTATTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCGCGCCAAATGGCGTAAATGTAGG
TACATTCACATTGGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAGAAACAAGCTGAAAATGTTAAAAACTACCTTTCTAAAGGGTCGCTGGCAGGTGTAGACGGGCGACTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
ATGTTAAACAGAGCAGTATTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCGCGCCAAATGGCGTAAATGTAGG
TACATTCACATTGGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAGAAACAAGCTGAAAATGTTAAAAACTACCTTTCTAAAGGGTCGCTGGCAGGTGTAGACGGGCGACTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
58.14 |
100 |
0.704 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.606 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
74.648 |
0.437 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
41.958 |
100 |
0.423 |
| ssbA | Streptococcus mutans UA159 |
40.845 |
100 |
0.408 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus mitis SK321 |
39.437 |
100 |
0.394 |