Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | KI234_RS04160 | Genome accession | NZ_CP076027 |
| Coordinates | 869169..869597 (+) | Length | 142 a.a. |
| NCBI ID | WP_000934385.1 | Uniprot ID | A0A2K0CLZ8 |
| Organism | Staphylococcus sp. MZ7 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 859781..903952 | 869169..869597 | within | 0 |
Gene organization within MGE regions
Location: 859781..903952
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KI234_RS04075 (KI234_04075) | sufU | 859781..860245 (+) | 465 | WP_001010512.1 | Fe-S cluster assembly sulfur transfer protein SufU | - |
| KI234_RS04080 (KI234_04080) | sufB | 860396..861793 (+) | 1398 | WP_001074405.1 | Fe-S cluster assembly protein SufB | - |
| KI234_RS04085 (KI234_04085) | - | 861861..862910 (-) | 1050 | WP_001145730.1 | tyrosine-type recombinase/integrase | - |
| KI234_RS04090 (KI234_04090) | - | 863107..863811 (-) | 705 | WP_017804779.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| KI234_RS04095 (KI234_04095) | - | 863843..864568 (-) | 726 | WP_000661437.1 | PH domain-containing protein | - |
| KI234_RS04100 (KI234_04100) | - | 864596..865270 (-) | 675 | WP_000775187.1 | ImmA/IrrE family metallo-endopeptidase | - |
| KI234_RS04105 (KI234_04105) | - | 865287..865619 (-) | 333 | WP_001055143.1 | helix-turn-helix transcriptional regulator | - |
| KI234_RS04110 (KI234_04110) | - | 865882..866076 (+) | 195 | WP_000108122.1 | helix-turn-helix transcriptional regulator | - |
| KI234_RS04115 (KI234_04115) | - | 866076..866843 (+) | 768 | WP_001002757.1 | phage antirepressor Ant | - |
| KI234_RS04120 (KI234_04120) | - | 866844..867068 (+) | 225 | WP_000187184.1 | hypothetical protein | - |
| KI234_RS04125 (KI234_04125) | - | 867108..867311 (+) | 204 | Protein_811 | hypothetical protein | - |
| KI234_RS04130 (KI234_04130) | - | 867279..867524 (-) | 246 | WP_000122246.1 | hypothetical protein | - |
| KI234_RS04135 (KI234_04135) | - | 867595..867816 (+) | 222 | WP_000977378.1 | hypothetical protein | - |
| KI234_RS04140 (KI234_04140) | - | 867809..867970 (+) | 162 | WP_000066017.1 | DUF1270 domain-containing protein | - |
| KI234_RS04145 (KI234_04145) | - | 868062..868322 (+) | 261 | WP_000291090.1 | DUF1108 family protein | - |
| KI234_RS04150 (KI234_04150) | - | 868332..868553 (+) | 222 | WP_000815401.1 | DUF2483 family protein | - |
| KI234_RS04155 (KI234_04155) | - | 868546..869169 (+) | 624 | WP_000139720.1 | DUF1071 domain-containing protein | - |
| KI234_RS04160 (KI234_04160) | ssbA | 869169..869597 (+) | 429 | WP_000934385.1 | single-stranded DNA-binding protein | Machinery gene |
| KI234_RS04165 (KI234_04165) | - | 869611..870285 (+) | 675 | WP_001124439.1 | putative HNHc nuclease | - |
| KI234_RS04170 (KI234_04170) | - | 870282..870431 (+) | 150 | WP_001081076.1 | hypothetical protein | - |
| KI234_RS04175 (KI234_04175) | - | 870424..870705 (-) | 282 | WP_000414755.1 | hypothetical protein | - |
| KI234_RS04180 (KI234_04180) | - | 870771..871541 (+) | 771 | WP_000190253.1 | conserved phage C-terminal domain-containing protein | - |
| KI234_RS04185 (KI234_04185) | - | 871551..872330 (+) | 780 | WP_000803062.1 | ATP-binding protein | - |
| KI234_RS04190 (KI234_04190) | - | 872324..872482 (+) | 159 | WP_000256590.1 | hypothetical protein | - |
| KI234_RS04195 (KI234_04195) | - | 872495..872716 (+) | 222 | WP_001123685.1 | DUF3269 family protein | - |
| KI234_RS04200 (KI234_04200) | - | 872727..873131 (+) | 405 | WP_000049810.1 | DUF1064 domain-containing protein | - |
| KI234_RS04205 (KI234_04205) | - | 873136..873321 (+) | 186 | WP_049317452.1 | DUF3113 family protein | - |
| KI234_RS04210 (KI234_04210) | - | 873322..873678 (+) | 357 | WP_000029369.1 | SA1788 family PVL leukocidin-associated protein | - |
| KI234_RS04215 (KI234_04215) | - | 873682..873924 (+) | 243 | WP_000131381.1 | phi PVL orf 51-like protein | - |
| KI234_RS04220 (KI234_04220) | - | 873939..874190 (+) | 252 | WP_025174939.1 | DUF1024 family protein | - |
| KI234_RS04225 (KI234_04225) | - | 874180..874353 (+) | 174 | WP_000028424.1 | hypothetical protein | - |
| KI234_RS04230 (KI234_04230) | - | 874354..874635 (+) | 282 | WP_000454994.1 | hypothetical protein | - |
| KI234_RS04235 (KI234_04235) | - | 874636..874797 (+) | 162 | WP_000889683.1 | hypothetical protein | - |
| KI234_RS04240 (KI234_04240) | - | 874812..875345 (+) | 534 | WP_025920701.1 | dUTP diphosphatase | - |
| KI234_RS04245 (KI234_04245) | - | 875382..875588 (+) | 207 | WP_000195827.1 | DUF1381 domain-containing protein | - |
| KI234_RS04250 (KI234_04250) | - | 875585..875779 (+) | 195 | Protein_836 | hypothetical protein | - |
| KI234_RS04255 (KI234_04255) | - | 875776..875979 (+) | 204 | WP_001072795.1 | hypothetical protein | - |
| KI234_RS04260 (KI234_04260) | - | 875972..876208 (+) | 237 | WP_000608278.1 | hypothetical protein | - |
| KI234_RS04265 (KI234_04265) | - | 876201..876374 (+) | 174 | WP_000595257.1 | transcriptional activator RinB | - |
| KI234_RS04270 (KI234_04270) | - | 876375..876521 (+) | 147 | WP_000990005.1 | hypothetical protein | - |
| KI234_RS04275 (KI234_04275) | - | 876545..876967 (+) | 423 | WP_000162701.1 | RinA family phage transcriptional activator | - |
| KI234_RS04280 (KI234_04280) | - | 877155..877649 (+) | 495 | WP_001038244.1 | terminase small subunit | - |
| KI234_RS04285 (KI234_04285) | - | 877652..878947 (+) | 1296 | WP_117172029.1 | PBSX family phage terminase large subunit | - |
| KI234_RS04290 (KI234_04290) | - | 878958..880496 (+) | 1539 | WP_214958327.1 | phage portal protein | - |
| KI234_RS04295 (KI234_04295) | - | 880503..881498 (+) | 996 | WP_001133041.1 | minor capsid protein | - |
| KI234_RS04300 (KI234_04300) | - | 881571..881741 (+) | 171 | WP_061732709.1 | hypothetical protein | - |
| KI234_RS04305 (KI234_04305) | - | 881876..882490 (+) | 615 | WP_000354305.1 | DUF4355 domain-containing protein | - |
| KI234_RS04310 (KI234_04310) | - | 882504..883478 (+) | 975 | WP_000438511.1 | phage major capsid protein | - |
| KI234_RS04315 (KI234_04315) | - | 883500..883787 (+) | 288 | WP_214958328.1 | hypothetical protein | - |
| KI234_RS04320 (KI234_04320) | - | 883796..884128 (+) | 333 | WP_214958329.1 | phage head-tail connector protein | - |
| KI234_RS04325 (KI234_04325) | - | 884125..884427 (+) | 303 | WP_001268312.1 | hypothetical protein | - |
| KI234_RS04330 (KI234_04330) | - | 884427..884774 (+) | 348 | WP_001017815.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| KI234_RS04335 (KI234_04335) | - | 884786..885169 (+) | 384 | WP_000188642.1 | hypothetical protein | - |
| KI234_RS04340 (KI234_04340) | - | 885188..885769 (+) | 582 | WP_000002577.1 | phage major tail protein, TP901-1 family | - |
| KI234_RS04345 (KI234_04345) | - | 885831..886196 (+) | 366 | WP_001100161.1 | tail assembly chaperone | - |
| KI234_RS04350 (KI234_04350) | - | 886226..886570 (+) | 345 | WP_000105584.1 | hypothetical protein | - |
| KI234_RS04355 (KI234_04355) | - | 886587..890054 (+) | 3468 | WP_072472461.1 | hypothetical protein | - |
| KI234_RS04360 (KI234_04360) | - | 890067..891014 (+) | 948 | WP_000350675.1 | phage tail family protein | - |
| KI234_RS04365 (KI234_04365) | - | 891023..892921 (+) | 1899 | WP_000152718.1 | SGNH/GDSL hydrolase family protein | - |
| KI234_RS04370 (KI234_04370) | - | 892936..894846 (+) | 1911 | WP_031928995.1 | hypothetical protein | - |
| KI234_RS04375 (KI234_04375) | - | 894846..896669 (+) | 1824 | WP_072472460.1 | phage baseplate upper protein | - |
| KI234_RS04380 (KI234_04380) | - | 896669..897046 (+) | 378 | WP_000705914.1 | DUF2977 domain-containing protein | - |
| KI234_RS04385 (KI234_04385) | - | 897056..897229 (+) | 174 | WP_001790193.1 | XkdX family protein | - |
| KI234_RS04390 (KI234_04390) | - | 897269..897568 (+) | 300 | WP_000466777.1 | DUF2951 domain-containing protein | - |
| KI234_RS04395 (KI234_04395) | - | 897705..899603 (+) | 1899 | WP_214958330.1 | glucosaminidase domain-containing protein | - |
| KI234_RS04400 (KI234_04400) | - | 899616..900854 (+) | 1239 | WP_069990338.1 | BppU family phage baseplate upper protein | - |
| KI234_RS04405 (KI234_04405) | - | 900860..901255 (+) | 396 | WP_000398874.1 | hypothetical protein | - |
| KI234_RS04410 (KI234_04410) | - | 901311..901586 (+) | 276 | WP_000351121.1 | phage holin | - |
| KI234_RS04415 (KI234_04415) | - | 901573..902985 (+) | 1413 | WP_001141515.1 | N-acetylmuramoyl-L-alanine amidase | - |
| KI234_RS04420 (KI234_04420) | eta | 903110..903952 (+) | 843 | WP_001065781.1 | exfoliative toxin A | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 15872.58 Da Isoelectric Point: 8.4825
>NTDB_id=571453 KI234_RS04160 WP_000934385.1 869169..869597(+) (ssbA) [Staphylococcus sp. MZ7]
MLNRAVLVGRLTKDPELRSAPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
MLNRAVLVGRLTKDPELRSAPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
Nucleotide
Download Length: 429 bp
>NTDB_id=571453 KI234_RS04160 WP_000934385.1 869169..869597(+) (ssbA) [Staphylococcus sp. MZ7]
ATGTTAAACAGAGCAGTATTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCGCGCCAAATGGCGTAAATGTAGG
TACATTCACATTGGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAGAAACAAGCTGAAAATGTTAAAAACTACCTTTCTAAAGGGTCGCTGGCAGGTGTAGACGGGCGACTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
ATGTTAAACAGAGCAGTATTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCGCGCCAAATGGCGTAAATGTAGG
TACATTCACATTGGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAGAAACAAGCTGAAAATGTTAAAAACTACCTTTCTAAAGGGTCGCTGGCAGGTGTAGACGGGCGACTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
58.14 |
100 |
0.704 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.606 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
74.648 |
0.437 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
41.958 |
100 |
0.423 |
| ssbA | Streptococcus mutans UA159 |
40.845 |
100 |
0.408 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus mitis SK321 |
39.437 |
100 |
0.394 |