Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | KI230_RS04175 | Genome accession | NZ_CP076026 |
| Coordinates | 874439..874867 (+) | Length | 142 a.a. |
| NCBI ID | WP_000934385.1 | Uniprot ID | A0A2K0CLZ8 |
| Organism | Staphylococcus sp. MZ3 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 865051..911616 | 874439..874867 | within | 0 |
Gene organization within MGE regions
Location: 865051..911616
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KI230_RS04090 (KI230_04090) | sufU | 865051..865515 (+) | 465 | WP_001010512.1 | Fe-S cluster assembly sulfur transfer protein SufU | - |
| KI230_RS04095 (KI230_04095) | sufB | 865666..867063 (+) | 1398 | WP_001074405.1 | Fe-S cluster assembly protein SufB | - |
| KI230_RS04100 (KI230_04100) | - | 867131..868180 (-) | 1050 | WP_001145730.1 | tyrosine-type recombinase/integrase | - |
| KI230_RS04105 (KI230_04105) | - | 868377..869081 (-) | 705 | WP_017804779.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| KI230_RS04110 (KI230_04110) | - | 869113..869838 (-) | 726 | WP_000661437.1 | PH domain-containing protein | - |
| KI230_RS04115 (KI230_04115) | - | 869866..870540 (-) | 675 | WP_000775187.1 | ImmA/IrrE family metallo-endopeptidase | - |
| KI230_RS04120 (KI230_04120) | - | 870557..870889 (-) | 333 | WP_001055143.1 | helix-turn-helix transcriptional regulator | - |
| KI230_RS04125 (KI230_04125) | - | 871152..871346 (+) | 195 | WP_000108122.1 | helix-turn-helix transcriptional regulator | - |
| KI230_RS04130 (KI230_04130) | - | 871346..872113 (+) | 768 | WP_001002757.1 | phage antirepressor Ant | - |
| KI230_RS04135 (KI230_04135) | - | 872114..872338 (+) | 225 | WP_000187184.1 | hypothetical protein | - |
| KI230_RS04140 (KI230_04140) | - | 872378..872581 (+) | 204 | Protein_811 | hypothetical protein | - |
| KI230_RS04145 (KI230_04145) | - | 872549..872794 (-) | 246 | WP_000122246.1 | hypothetical protein | - |
| KI230_RS04150 (KI230_04150) | - | 872865..873086 (+) | 222 | WP_000977378.1 | hypothetical protein | - |
| KI230_RS04155 (KI230_04155) | - | 873079..873240 (+) | 162 | WP_000066017.1 | DUF1270 domain-containing protein | - |
| KI230_RS04160 (KI230_04160) | - | 873332..873592 (+) | 261 | WP_000291090.1 | DUF1108 family protein | - |
| KI230_RS04165 (KI230_04165) | - | 873602..873823 (+) | 222 | WP_000815401.1 | DUF2483 family protein | - |
| KI230_RS04170 (KI230_04170) | - | 873816..874439 (+) | 624 | WP_000139720.1 | DUF1071 domain-containing protein | - |
| KI230_RS04175 (KI230_04175) | ssbA | 874439..874867 (+) | 429 | WP_000934385.1 | single-stranded DNA-binding protein | Machinery gene |
| KI230_RS04180 (KI230_04180) | - | 874881..875555 (+) | 675 | WP_001124439.1 | putative HNHc nuclease | - |
| KI230_RS04185 (KI230_04185) | - | 875552..875701 (+) | 150 | WP_001081076.1 | hypothetical protein | - |
| KI230_RS04190 (KI230_04190) | - | 875694..875975 (-) | 282 | WP_000414755.1 | hypothetical protein | - |
| KI230_RS04195 (KI230_04195) | - | 876041..876811 (+) | 771 | WP_000190253.1 | conserved phage C-terminal domain-containing protein | - |
| KI230_RS04200 (KI230_04200) | - | 876821..877600 (+) | 780 | WP_000803062.1 | ATP-binding protein | - |
| KI230_RS04205 (KI230_04205) | - | 877594..877752 (+) | 159 | WP_000256590.1 | hypothetical protein | - |
| KI230_RS04210 (KI230_04210) | - | 877765..877986 (+) | 222 | WP_001123685.1 | DUF3269 family protein | - |
| KI230_RS04215 (KI230_04215) | - | 877997..878401 (+) | 405 | WP_000049810.1 | DUF1064 domain-containing protein | - |
| KI230_RS04220 (KI230_04220) | - | 878406..878591 (+) | 186 | WP_049317452.1 | DUF3113 family protein | - |
| KI230_RS04225 (KI230_04225) | - | 878592..878948 (+) | 357 | WP_000029369.1 | SA1788 family PVL leukocidin-associated protein | - |
| KI230_RS04230 (KI230_04230) | - | 878952..879194 (+) | 243 | WP_000131381.1 | phi PVL orf 51-like protein | - |
| KI230_RS04235 (KI230_04235) | - | 879209..879460 (+) | 252 | WP_025174939.1 | DUF1024 family protein | - |
| KI230_RS04240 (KI230_04240) | - | 879450..879623 (+) | 174 | WP_000028424.1 | hypothetical protein | - |
| KI230_RS04245 (KI230_04245) | - | 879624..879905 (+) | 282 | WP_000454994.1 | hypothetical protein | - |
| KI230_RS04250 (KI230_04250) | - | 879906..880067 (+) | 162 | WP_000889683.1 | hypothetical protein | - |
| KI230_RS04255 (KI230_04255) | - | 880082..880615 (+) | 534 | WP_025920701.1 | dUTP diphosphatase | - |
| KI230_RS04260 (KI230_04260) | - | 880652..880858 (+) | 207 | WP_000195827.1 | DUF1381 domain-containing protein | - |
| KI230_RS04265 (KI230_04265) | - | 880855..881049 (+) | 195 | Protein_836 | hypothetical protein | - |
| KI230_RS04270 (KI230_04270) | - | 881046..881249 (+) | 204 | WP_001072795.1 | hypothetical protein | - |
| KI230_RS04275 (KI230_04275) | - | 881242..881478 (+) | 237 | WP_000608278.1 | hypothetical protein | - |
| KI230_RS04280 (KI230_04280) | - | 881471..881644 (+) | 174 | WP_000595257.1 | transcriptional activator RinB | - |
| KI230_RS04285 (KI230_04285) | - | 881645..881791 (+) | 147 | WP_000990005.1 | hypothetical protein | - |
| KI230_RS04290 (KI230_04290) | - | 881815..882237 (+) | 423 | WP_000162701.1 | RinA family phage transcriptional activator | - |
| KI230_RS04295 (KI230_04295) | - | 882425..882919 (+) | 495 | WP_001038244.1 | terminase small subunit | - |
| KI230_RS04300 (KI230_04300) | - | 882922..884217 (+) | 1296 | WP_117172029.1 | PBSX family phage terminase large subunit | - |
| KI230_RS04305 (KI230_04305) | - | 884228..885766 (+) | 1539 | WP_214958327.1 | phage portal protein | - |
| KI230_RS04310 (KI230_04310) | - | 885773..886768 (+) | 996 | WP_001133041.1 | minor capsid protein | - |
| KI230_RS04315 (KI230_04315) | - | 886841..887011 (+) | 171 | WP_061732709.1 | hypothetical protein | - |
| KI230_RS04320 (KI230_04320) | - | 887146..887760 (+) | 615 | WP_000354305.1 | DUF4355 domain-containing protein | - |
| KI230_RS04325 (KI230_04325) | - | 887774..888748 (+) | 975 | WP_000438511.1 | phage major capsid protein | - |
| KI230_RS04330 (KI230_04330) | - | 888770..889057 (+) | 288 | WP_214958328.1 | hypothetical protein | - |
| KI230_RS04335 (KI230_04335) | - | 889066..889398 (+) | 333 | WP_214958329.1 | phage head-tail connector protein | - |
| KI230_RS04340 (KI230_04340) | - | 889395..889697 (+) | 303 | WP_001268312.1 | hypothetical protein | - |
| KI230_RS04345 (KI230_04345) | - | 889697..890044 (+) | 348 | WP_001017815.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| KI230_RS04350 (KI230_04350) | - | 890056..890439 (+) | 384 | WP_000188642.1 | hypothetical protein | - |
| KI230_RS04355 (KI230_04355) | - | 890458..891039 (+) | 582 | WP_000002577.1 | phage major tail protein, TP901-1 family | - |
| KI230_RS04360 (KI230_04360) | - | 891101..891466 (+) | 366 | WP_001100161.1 | tail assembly chaperone | - |
| KI230_RS04365 (KI230_04365) | - | 891496..891840 (+) | 345 | WP_000105584.1 | hypothetical protein | - |
| KI230_RS04370 (KI230_04370) | - | 891857..895324 (+) | 3468 | WP_072472461.1 | hypothetical protein | - |
| KI230_RS04375 (KI230_04375) | - | 895337..896284 (+) | 948 | WP_000350675.1 | phage tail family protein | - |
| KI230_RS04380 (KI230_04380) | - | 896293..898191 (+) | 1899 | WP_000152718.1 | SGNH/GDSL hydrolase family protein | - |
| KI230_RS04385 (KI230_04385) | - | 898206..900116 (+) | 1911 | WP_031928995.1 | hypothetical protein | - |
| KI230_RS04390 (KI230_04390) | - | 900116..901939 (+) | 1824 | WP_072472460.1 | phage baseplate upper protein | - |
| KI230_RS04395 (KI230_04395) | - | 901939..902316 (+) | 378 | WP_000705914.1 | DUF2977 domain-containing protein | - |
| KI230_RS04400 (KI230_04400) | - | 902326..902499 (+) | 174 | WP_001790193.1 | XkdX family protein | - |
| KI230_RS04405 (KI230_04405) | - | 902539..902838 (+) | 300 | WP_000466777.1 | DUF2951 domain-containing protein | - |
| KI230_RS04410 (KI230_04410) | - | 902975..904873 (+) | 1899 | WP_214958330.1 | glucosaminidase domain-containing protein | - |
| KI230_RS04415 (KI230_04415) | - | 904886..906124 (+) | 1239 | WP_069990338.1 | BppU family phage baseplate upper protein | - |
| KI230_RS04420 (KI230_04420) | - | 906130..906525 (+) | 396 | WP_000398874.1 | hypothetical protein | - |
| KI230_RS04425 (KI230_04425) | - | 906581..906856 (+) | 276 | WP_000351121.1 | phage holin | - |
| KI230_RS04430 (KI230_04430) | - | 906843..908255 (+) | 1413 | WP_001141515.1 | N-acetylmuramoyl-L-alanine amidase | - |
| KI230_RS04435 (KI230_04435) | eta | 908380..909222 (+) | 843 | WP_001065781.1 | exfoliative toxin A | - |
| KI230_RS04440 (KI230_04440) | - | 909754..909891 (+) | 138 | WP_001790198.1 | chorismate mutase | - |
| KI230_RS04445 (KI230_04445) | - | 909897..910211 (-) | 315 | Protein_872 | hypothetical protein | - |
| KI230_RS04450 (KI230_04450) | - | 910576..911616 (+) | 1041 | WP_045178105.1 | HlyC/CorC family transporter | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 15872.58 Da Isoelectric Point: 8.4825
>NTDB_id=571411 KI230_RS04175 WP_000934385.1 874439..874867(+) (ssbA) [Staphylococcus sp. MZ3]
MLNRAVLVGRLTKDPELRSAPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
MLNRAVLVGRLTKDPELRSAPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
Nucleotide
Download Length: 429 bp
>NTDB_id=571411 KI230_RS04175 WP_000934385.1 874439..874867(+) (ssbA) [Staphylococcus sp. MZ3]
ATGTTAAACAGAGCAGTATTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCGCGCCAAATGGCGTAAATGTAGG
TACATTCACATTGGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAGAAACAAGCTGAAAATGTTAAAAACTACCTTTCTAAAGGGTCGCTGGCAGGTGTAGACGGGCGACTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
ATGTTAAACAGAGCAGTATTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCGCGCCAAATGGCGTAAATGTAGG
TACATTCACATTGGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAGAAACAAGCTGAAAATGTTAAAAACTACCTTTCTAAAGGGTCGCTGGCAGGTGTAGACGGGCGACTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
58.14 |
100 |
0.704 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.606 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
74.648 |
0.437 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
41.958 |
100 |
0.423 |
| ssbA | Streptococcus mutans UA159 |
40.845 |
100 |
0.408 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus mitis SK321 |
39.437 |
100 |
0.394 |