Detailed information NTG0057132

Bioinformatically predicted

Overview

• Name: pilE
• Type: Machinery gene
• Locus tag: R2APBS1_RS04495
• Genome accession: NC_020541
• Coordinates: 1031275..1031715 (-)
• Length: 146 a.a.
• NCBI ID: WP_015447048.1
• Uniprot ID: M4NEV3
• Organism: Rhodanobacter denitrificans
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	1019719..1031208	1031275..1031715	flank	67

Gene organization within MGE regions

Location: 1019719..1031715

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
R2APBS1_RS04465 (R2APBS1_0913)	-	1019719..1020972 (+)	1254	WP_015447039.1	glycosyltransferase family 4 protein	-
R2APBS1_RS04470 (R2APBS1_0914)	-	1020969..1021265 (+)	297	WP_015447040.1	hypothetical protein	-
R2APBS1_RS04475 (R2APBS1_0915)	-	1021262..1022212 (+)	951	WP_015447041.1	glycosyltransferase family 2 protein	-
R2APBS1_RS19520 (R2APBS1_0916)	-	1022196..1023095 (+)	900	WP_157769697.1	glycosyltransferase	-
R2APBS1_RS19525 (R2APBS1_0917)	-	1023155..1024162 (-)	1008	WP_157769698.1	glycosyltransferase	-
R2APBS1_RS19530 (R2APBS1_0918)	-	1024159..1025241 (-)	1083	WP_015447044.1	class I SAM-dependent methyltransferase	-
R2APBS1_RS04480 (R2APBS1_0919)	-	1025513..1026760 (-)	1248	WP_015447045.1	lipopolysaccharide biosynthesis protein	-
R2APBS1_RS20005	-	1026955..1027125 (-)	171	WP_157769699.1	hypothetical protein	-
R2APBS1_RS04485 (R2APBS1_0920)	-	1027232..1029196 (-)	1965	WP_015447046.1	hypothetical protein	-
R2APBS1_RS04490 (R2APBS1_0921)	-	1029196..1031208 (-)	2013	WP_015447047.1	hypothetical protein	-
R2APBS1_RS04495 (R2APBS1_0922)	pilE	1031275..1031715 (-)	441	WP_015447048.1	pilin	Machinery gene

Sequence

Protein

• Length: 146 a.a.
• Molecular weight: 15317.81 Da
• Isoelectric Point: 10.0547

>NTDB_id=57132 R2APBS1_RS04495 WP_015447048.1 1031275..1031715(-) (pilE) [Rhodanobacter denitrificans]
MKKMQKGFTLIELMIVVAIIAILAAIAIPAYQDYLIRTQVSEGAVLTDGAKTAVAEFYSNRGALTNAKNASIGLAQSQSI
NGQYVSKVDVVGGVITASFGGPKANVTALPSSKTFVLSPITQAGSIKWTCTGSTVDQKYLPTSCRK

Nucleotide

• Length: 441 bp

>NTDB_id=57132 R2APBS1_RS04495 WP_015447048.1 1031275..1031715(-) (pilE) [Rhodanobacter denitrificans]
ATGAAGAAGATGCAGAAGGGCTTCACCCTGATCGAACTGATGATCGTGGTCGCGATCATCGCGATCCTCGCCGCGATCGC
CATCCCTGCCTACCAGGATTACCTGATCCGTACGCAGGTGTCCGAGGGCGCGGTGCTGACCGACGGCGCCAAGACGGCTG
TTGCCGAGTTCTACTCGAACCGTGGCGCCCTGACCAATGCCAAGAACGCCAGTATCGGTTTGGCGCAATCCCAAAGCATC
AACGGACAGTACGTCAGCAAAGTTGATGTTGTGGGTGGCGTCATTACCGCCTCGTTCGGTGGCCCGAAGGCGAACGTGAC
AGCCCTGCCCAGCTCCAAGACTTTCGTGCTCTCGCCCATCACCCAGGCCGGGTCGATCAAGTGGACCTGTACTGGGTCGA
CGGTCGATCAGAAGTACCTGCCAACTTCGTGCCGCAAGTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (3-27)

• Pilin (bacterial filament) (Pilin) (37-145)

3D structure

• AlphaFold DB: M4NEV3

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilE	Neisseria gonorrhoeae strain FA1090	44.72	100	0.493
pilA2	Legionella pneumophila str. Paris	48.951	97.945	0.479
pilA2	Legionella pneumophila strain ERS1305867	48.611	98.63	0.479
pilE	Neisseria gonorrhoeae MS11	42.593	100	0.473
pilA	Ralstonia pseudosolanacearum GMI1000	40.237	100	0.466
comP	Acinetobacter baylyi ADP1	42.857	100	0.432
pilA/pilA1	Eikenella corrodens VA1	39.873	100	0.432
pilA/pilAI	Pseudomonas stutzeri DSM 10701	38.158	100	0.397
pilA	Acinetobacter baumannii strain A118	39.31	99.315	0.39
pilA	Pseudomonas aeruginosa PAK	35.897	100	0.384