Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | SAI7S6_RS10100 | Genome accession | NC_020537 |
| Coordinates | 2018117..2018542 (-) | Length | 141 a.a. |
| NCBI ID | WP_000934384.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus subsp. aureus ST228 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1984671..2024202 | 2018117..2018542 | within | 0 |
Gene organization within MGE regions
Location: 1984671..2024202
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SAI7S6_RS09855 | scn | 1984671..1985021 (-) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| SAI7S6_RS09860 | - | 1985532..1985867 (-) | 336 | Protein_1868 | SH3 domain-containing protein | - |
| SAI7S6_RS09865 (SAI7S6_1014720) | sak | 1986518..1987009 (-) | 492 | WP_000920038.1 | staphylokinase | - |
| SAI7S6_RS09870 (SAI7S6_1014730) | - | 1987200..1987955 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| SAI7S6_RS09875 | - | 1987967..1988221 (-) | 255 | WP_000611512.1 | phage holin | - |
| SAI7S6_RS14835 | - | 1988273..1988380 (+) | 108 | WP_031762631.1 | hypothetical protein | - |
| SAI7S6_RS15625 | pepG1 | 1988433..1988567 (-) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| SAI7S6_RS09890 (SAI7S6_1014740) | sea | 1988718..1989491 (-) | 774 | WP_000750412.1 | staphylococcal enterotoxin type A | - |
| SAI7S6_RS09895 | - | 1989864..1990238 (-) | 375 | WP_000340977.1 | hypothetical protein | - |
| SAI7S6_RS09900 | - | 1990294..1990581 (-) | 288 | WP_001262621.1 | hypothetical protein | - |
| SAI7S6_RS14840 | - | 1990627..1990779 (-) | 153 | WP_001000058.1 | hypothetical protein | - |
| SAI7S6_RS09910 (SAI7S6_1014750) | - | 1990772..1994554 (-) | 3783 | WP_015445885.1 | phage tail spike protein | - |
| SAI7S6_RS09915 (SAI7S6_1014760) | - | 1994570..1996054 (-) | 1485 | WP_000567390.1 | phage tail domain-containing protein | - |
| SAI7S6_RS09920 (SAI7S6_1014770) | - | 1996051..2000580 (-) | 4530 | WP_015445887.1 | phage tail tape measure protein | - |
| SAI7S6_RS16075 | - | 2000637..2000774 (-) | 138 | WP_001549167.1 | hypothetical protein | - |
| SAI7S6_RS09930 | - | 2000825..2001175 (-) | 351 | WP_001096355.1 | hypothetical protein | - |
| SAI7S6_RS15630 | - | 2001225..2001455 (-) | 231 | Protein_1883 | Ig-like domain-containing protein | - |
| SAI7S6_RS09935 (SAI7S6_1014780) | - | 2001491..2002135 (-) | 645 | WP_000268741.1 | major tail protein | - |
| SAI7S6_RS09940 | - | 2002136..2002543 (-) | 408 | WP_000565498.1 | hypothetical protein | - |
| SAI7S6_RS09945 | - | 2002540..2002944 (-) | 405 | WP_000114225.1 | HK97 gp10 family phage protein | - |
| SAI7S6_RS09950 | - | 2002941..2003303 (-) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| SAI7S6_RS09955 | - | 2003287..2003571 (-) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| SAI7S6_RS09960 | - | 2003561..2003845 (-) | 285 | WP_000238236.1 | hypothetical protein | - |
| SAI7S6_RS09965 (SAI7S6_1014790) | - | 2003865..2005010 (-) | 1146 | WP_000154555.1 | phage major capsid protein | - |
| SAI7S6_RS09970 (SAI7S6_1014800) | - | 2005034..2005771 (-) | 738 | WP_000861914.1 | head maturation protease, ClpP-related | - |
| SAI7S6_RS09975 (SAI7S6_1014810) | - | 2005755..2006942 (-) | 1188 | WP_000025274.1 | phage portal protein | - |
| SAI7S6_RS09980 (SAI7S6_1014820) | - | 2006958..2008619 (-) | 1662 | WP_015445889.1 | terminase large subunit | - |
| SAI7S6_RS09985 | - | 2008616..2008960 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| SAI7S6_RS09990 | - | 2009090..2009389 (-) | 300 | WP_000988336.1 | HNH endonuclease | - |
| SAI7S6_RS09995 | - | 2009621..2010037 (-) | 417 | WP_000590126.1 | hypothetical protein | - |
| SAI7S6_RS10000 | - | 2010065..2010265 (-) | 201 | WP_000265041.1 | DUF1514 family protein | - |
| SAI7S6_RS10005 | - | 2010265..2010414 (-) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| SAI7S6_RS10010 | - | 2010411..2010617 (-) | 207 | WP_000195820.1 | DUF1381 domain-containing protein | - |
| SAI7S6_RS10015 (SAI7S6_1014830) | - | 2010654..2011190 (-) | 537 | WP_000185680.1 | dUTPase | - |
| SAI7S6_RS10020 | - | 2011183..2011431 (-) | 249 | WP_041174218.1 | DUF1024 family protein | - |
| SAI7S6_RS10025 | - | 2011424..2011732 (-) | 309 | WP_001614813.1 | hypothetical protein | - |
| SAI7S6_RS10030 | - | 2011729..2012076 (-) | 348 | WP_000979209.1 | YopX family protein | - |
| SAI7S6_RS10035 | - | 2012073..2012474 (-) | 402 | WP_000695762.1 | hypothetical protein | - |
| SAI7S6_RS10040 | - | 2012487..2012735 (-) | 249 | WP_012068339.1 | SAV1978 family virulence-associated passenger protein | - |
| SAI7S6_RS10045 | - | 2012735..2012989 (-) | 255 | WP_000022735.1 | DUF3310 domain-containing protein | - |
| SAI7S6_RS10050 | - | 2013075..2013260 (-) | 186 | WP_001187230.1 | DUF3113 family protein | - |
| SAI7S6_RS10055 | - | 2013265..2013669 (-) | 405 | WP_031895320.1 | DUF1064 domain-containing protein | - |
| SAI7S6_RS10060 | - | 2013666..2014091 (-) | 426 | WP_000451861.1 | phage N-6-adenine-methyltransferase | - |
| SAI7S6_RS10065 | - | 2014101..2014322 (-) | 222 | WP_001123688.1 | DUF3269 family protein | - |
| SAI7S6_RS10070 | - | 2014326..2014541 (-) | 216 | WP_001024405.1 | hypothetical protein | - |
| SAI7S6_RS10075 (SAI7S6_1014840) | - | 2014538..2015779 (-) | 1242 | WP_015445891.1 | DnaB helicase C-terminal domain-containing protein | - |
| SAI7S6_RS10080 | - | 2015776..2016132 (-) | 357 | WP_001132243.1 | hypothetical protein | - |
| SAI7S6_RS10085 (SAI7S6_1014850) | - | 2016132..2016887 (-) | 756 | WP_001037657.1 | DnaD domain protein | - |
| SAI7S6_RS10090 (SAI7S6_1014860) | - | 2016880..2017554 (-) | 675 | WP_015445893.1 | putative HNHc nuclease | - |
| SAI7S6_RS10095 (SAI7S6_1014870) | - | 2017555..2018106 (-) | 552 | WP_001004506.1 | NUMOD4 domain-containing protein | - |
| SAI7S6_RS10100 | ssbA | 2018117..2018542 (-) | 426 | WP_000934384.1 | single-stranded DNA-binding protein | Machinery gene |
| SAI7S6_RS10105 (SAI7S6_1014880) | - | 2018542..2019165 (-) | 624 | WP_000139720.1 | DUF1071 domain-containing protein | - |
| SAI7S6_RS10110 | - | 2019158..2019379 (-) | 222 | WP_000815403.1 | DUF2483 family protein | - |
| SAI7S6_RS10115 | - | 2019389..2019649 (-) | 261 | WP_000291076.1 | DUF1108 family protein | - |
| SAI7S6_RS14845 | - | 2019741..2019902 (-) | 162 | WP_000066021.1 | DUF1270 family protein | - |
| SAI7S6_RS10125 | - | 2019914..2020177 (-) | 264 | WP_001124198.1 | helix-turn-helix domain-containing protein | - |
| SAI7S6_RS16190 | - | 2020327..2020425 (-) | 99 | Protein_1923 | hypothetical protein | - |
| SAI7S6_RS10135 | - | 2020422..2020748 (-) | 327 | WP_001025595.1 | hypothetical protein | - |
| SAI7S6_RS10140 (SAI7S6_1014890) | - | 2020804..2021436 (+) | 633 | WP_001814660.1 | hypothetical protein | - |
| SAI7S6_RS14850 | - | 2021451..2021591 (-) | 141 | WP_000939500.1 | hypothetical protein | - |
| SAI7S6_RS10150 (SAI7S6_1014900) | groL | 2022226..2023842 (-) | 1617 | WP_000240642.1 | chaperonin GroEL | - |
| SAI7S6_RS10155 | groES | 2023918..2024202 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15784.48 Da Isoelectric Point: 8.4826
>NTDB_id=57060 SAI7S6_RS10100 WP_000934384.1 2018117..2018542(-) (ssbA) [Staphylococcus aureus subsp. aureus ST228]
MLNRAVLVGRLTKDPELRSAPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNNADSIEDLPF
MLNRAVLVGRLTKDPELRSAPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNNADSIEDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=57060 SAI7S6_RS10100 WP_000934384.1 2018117..2018542(-) (ssbA) [Staphylococcus aureus subsp. aureus ST228]
ATGTTAAACAGAGCAGTATTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCGCGCCAAATGGCGTAAATGTAGG
TACATTCACATTGGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAGAAACAAGCTGAAAATGTTAAAAACTACCTTTCTAAAGGGTCGCTGGCAGGTGTAGACGGGCGATTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAACAACGCAG
ACTCTATAGAGGATCTTCCTTTTTAG
ATGTTAAACAGAGCAGTATTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCGCGCCAAATGGCGTAAATGTAGG
TACATTCACATTGGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAGAAACAAGCTGAAAATGTTAAAAACTACCTTTCTAAAGGGTCGCTGGCAGGTGTAGACGGGCGATTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAACAACGCAG
ACTCTATAGAGGATCTTCCTTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
73.729 |
83.688 |
0.617 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50 |
100 |
0.603 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
75.177 |
0.44 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
41.844 |
100 |
0.418 |
| ssbA | Streptococcus mutans UA159 |
46.087 |
81.56 |
0.376 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
44.915 |
83.688 |
0.376 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
44.915 |
83.688 |
0.376 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
44.068 |
83.688 |
0.369 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
44.068 |
83.688 |
0.369 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
44.068 |
83.688 |
0.369 |
| ssbB/cilA | Streptococcus mitis SK321 |
44.068 |
83.688 |
0.369 |