Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | KI818_RS05550 | Genome accession | NZ_CP075562 |
| Coordinates | 1115365..1115676 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain Sta2021010 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1110365..1120676
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KI818_RS05515 (KI818_05485) | gcvPA | 1110867..1112213 (-) | 1347 | WP_000019692.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| KI818_RS05520 (KI818_05490) | gcvT | 1112233..1113324 (-) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| KI818_RS05525 (KI818_05495) | - | 1113483..1114007 (-) | 525 | WP_001015120.1 | shikimate kinase | - |
| KI818_RS05530 (KI818_05500) | - | 1113997..1114143 (-) | 147 | WP_001792109.1 | hypothetical protein | - |
| KI818_RS05535 (KI818_05505) | comGF | 1114240..1114737 (-) | 498 | WP_001788897.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| KI818_RS05540 (KI818_05510) | comGE | 1114655..1114954 (-) | 300 | WP_000844410.1 | hypothetical protein | Machinery gene |
| KI818_RS05545 (KI818_05515) | comGD | 1114941..1115387 (-) | 447 | WP_001788899.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| KI818_RS05550 (KI818_05520) | comGC | 1115365..1115676 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| KI818_RS05555 (KI818_05525) | comGB | 1115690..1116760 (-) | 1071 | WP_000776422.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| KI818_RS05560 (KI818_05530) | comGA | 1116732..1117706 (-) | 975 | WP_000697217.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| KI818_RS05565 (KI818_05535) | - | 1117758..1118381 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| KI818_RS05570 (KI818_05540) | - | 1118378..1118707 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| KI818_RS05575 (KI818_05545) | - | 1118707..1119693 (-) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| KI818_RS05580 (KI818_05550) | - | 1119690..1119893 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=569601 KI818_RS05550 WP_000472256.1 1115365..1115676(-) (comGC) [Staphylococcus aureus strain Sta2021010]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=569601 KI818_RS05550 WP_000472256.1 1115365..1115676(-) (comGC) [Staphylococcus aureus strain Sta2021010]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |