Detailed information NTG0557352

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: KAJ74_RS13685
• Genome accession: NZ_CP073012
• Coordinates: 2788395..2788706 (+)
• Length: 103 a.a.
• NCBI ID: WP_000472256.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain SA14+
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2783395..2793706

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
KAJ74_RS13655 (KAJ74_13655)	-	2784178..2784381 (+)	204	WP_000087561.1	YqgQ family protein	-
KAJ74_RS13660 (KAJ74_13660)	-	2784378..2785364 (+)	987	WP_000161314.1	ROK family glucokinase	-
KAJ74_RS13665 (KAJ74_13665)	-	2785364..2785693 (+)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
KAJ74_RS13670 (KAJ74_13670)	-	2785690..2786313 (+)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
KAJ74_RS13675 (KAJ74_13675)	comGA	2786365..2787339 (+)	975	WP_031587486.1	competence type IV pilus ATPase ComGA	Machinery gene
KAJ74_RS13680 (KAJ74_13680)	comGB	2787311..2788381 (+)	1071	WP_000776422.1	competence type IV pilus assembly protein ComGB	Machinery gene
KAJ74_RS13685 (KAJ74_13685)	comGC	2788395..2788706 (+)	312	WP_000472256.1	competence type IV pilus major pilin ComGC	Machinery gene
KAJ74_RS13690 (KAJ74_13690)	comGD	2788684..2789130 (+)	447	WP_001788899.1	competence type IV pilus minor pilin ComGD	Machinery gene
KAJ74_RS13695 (KAJ74_13695)	comGE	2789117..2789416 (+)	300	WP_000844413.1	hypothetical protein	Machinery gene
KAJ74_RS13700 (KAJ74_13700)	comGF	2789334..2789831 (+)	498	WP_029694050.1	competence type IV pilus minor pilin ComGF	Machinery gene
KAJ74_RS13705 (KAJ74_13705)	-	2789928..2790074 (+)	147	WP_001792109.1	hypothetical protein	-
KAJ74_RS13710 (KAJ74_13710)	-	2790064..2790588 (+)	525	WP_001015120.1	shikimate kinase	-
KAJ74_RS13715 (KAJ74_13715)	gcvT	2790747..2791838 (+)	1092	WP_000093348.1	glycine cleavage system aminomethyltransferase GcvT	-
KAJ74_RS13720 (KAJ74_13720)	gcvPA	2791858..2793204 (+)	1347	WP_000019690.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11315.36 Da
• Isoelectric Point: 8.5268

>NTDB_id=557352 KAJ74_RS13685 WP_000472256.1 2788395..2788706(+) (comGC) [Staphylococcus aureus strain SA14+]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=557352 KAJ74_RS13685 WP_000472256.1 2788395..2788706(+) (comGC) [Staphylococcus aureus strain SA14+]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	100	100	1
comGC	Staphylococcus aureus N315	100	100	1
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369