Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | LUY99_RS02330 | Genome accession | NZ_CP089479 |
| Coordinates | 497359..497670 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | A0A0H2XGS7 |
| Organism | Staphylococcus aureus strain 0073_III_ST239 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 492359..502670
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LUY99_RS02295 | gcvPA | 492861..494207 (-) | 1347 | WP_000019687.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| LUY99_RS02300 | gcvT | 494227..495318 (-) | 1092 | WP_000093351.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| LUY99_RS02305 | - | 495477..496001 (-) | 525 | WP_001015117.1 | shikimate kinase | - |
| LUY99_RS02310 | - | 495991..496137 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| LUY99_RS02315 | comGF | 496234..496731 (-) | 498 | WP_001803317.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| LUY99_RS02320 | comGE | 496649..496948 (-) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| LUY99_RS02325 | comGD | 496935..497381 (-) | 447 | WP_001790850.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| LUY99_RS02330 | comGC | 497359..497670 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| LUY99_RS02335 | comGB | 497684..498754 (-) | 1071 | WP_000775706.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| LUY99_RS02340 | comGA | 498726..499700 (-) | 975 | WP_000697228.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| LUY99_RS02345 | - | 499752..500375 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| LUY99_RS02350 | - | 500372..500701 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| LUY99_RS02355 | - | 500701..501687 (-) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| LUY99_RS02360 | - | 501684..501887 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=550501 LUY99_RS02330 WP_000472256.1 497359..497670(-) (comGC) [Staphylococcus aureus strain 0073_III_ST239]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=550501 LUY99_RS02330 WP_000472256.1 497359..497670(-) (comGC) [Staphylococcus aureus strain 0073_III_ST239]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comGC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comGC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |