Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | J5F47_RS12990 | Genome accession | NZ_CP071931 |
| Coordinates | 2363992..2364411 (-) | Length | 139 a.a. |
| NCBI ID | WP_049142657.1 | Uniprot ID | - |
| Organism | Enterococcus faecium strain VRE3355 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 2355416..2407689 | 2363992..2364411 | within | 0 |
Gene organization within MGE regions
Location: 2355416..2407689
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| J5F47_RS12930 (J5F47_12940) | - | 2355566..2355829 (-) | 264 | WP_049142664.1 | hypothetical protein | - |
| J5F47_RS12935 (J5F47_12945) | - | 2356375..2356590 (-) | 216 | WP_208284714.1 | SdpI family protein | - |
| J5F47_RS12940 (J5F47_12950) | - | 2356718..2357467 (-) | 750 | WP_243899949.1 | hypothetical protein | - |
| J5F47_RS12945 (J5F47_12955) | - | 2357538..2357756 (-) | 219 | WP_049142662.1 | hypothetical protein | - |
| J5F47_RS12950 (J5F47_12960) | - | 2357812..2358819 (-) | 1008 | WP_208284715.1 | radical SAM protein | - |
| J5F47_RS15540 | - | 2359041..2359397 (-) | 357 | WP_243899950.1 | ATP-binding cassette domain-containing protein | - |
| J5F47_RS15545 | - | 2359756..2360202 (-) | 447 | WP_243899951.1 | hypothetical protein | - |
| J5F47_RS12965 (J5F47_12975) | - | 2360314..2361486 (+) | 1173 | WP_000195429.1 | IS256-like element IS256 family transposase | - |
| J5F47_RS12970 (J5F47_12980) | - | 2361794..2362282 (-) | 489 | WP_049142660.1 | thioredoxin family protein | - |
| J5F47_RS12980 (J5F47_12990) | - | 2363173..2363604 (-) | 432 | WP_049142659.1 | DNA/RNA non-specific endonuclease | - |
| J5F47_RS12985 (J5F47_12995) | - | 2363619..2363915 (-) | 297 | WP_049142658.1 | hypothetical protein | - |
| J5F47_RS12990 (J5F47_13000) | ssb | 2363992..2364411 (-) | 420 | WP_049142657.1 | single-stranded DNA-binding protein | Machinery gene |
| J5F47_RS12995 (J5F47_13005) | - | 2364466..2364807 (-) | 342 | WP_049142656.1 | hypothetical protein | - |
| J5F47_RS13000 (J5F47_13010) | - | 2364879..2365145 (-) | 267 | WP_049142678.1 | hypothetical protein | - |
| J5F47_RS13005 (J5F47_13015) | - | 2365632..2366543 (-) | 912 | WP_049142655.1 | replication-relaxation family protein | - |
| J5F47_RS13010 (J5F47_13020) | - | 2367486..2367908 (-) | 423 | WP_049142654.1 | thioredoxin family protein | - |
| J5F47_RS13015 (J5F47_13025) | - | 2367898..2370072 (-) | 2175 | WP_053089540.1 | TraM recognition domain-containing protein | - |
| J5F47_RS13020 (J5F47_13030) | - | 2370088..2372430 (-) | 2343 | WP_049142653.1 | hypothetical protein | - |
| J5F47_RS13025 (J5F47_13035) | - | 2372452..2374995 (-) | 2544 | WP_049142652.1 | ATP-binding protein | - |
| J5F47_RS13030 (J5F47_13040) | - | 2375005..2375403 (-) | 399 | WP_049142651.1 | TcpE family conjugal transfer membrane protein | - |
| J5F47_RS13035 (J5F47_13045) | - | 2375484..2375768 (-) | 285 | WP_053089539.1 | hypothetical protein | - |
| J5F47_RS13040 (J5F47_13050) | - | 2375792..2376790 (-) | 999 | WP_049142649.1 | conjugal transfer protein | - |
| J5F47_RS13045 (J5F47_13055) | - | 2376783..2377130 (-) | 348 | WP_049142648.1 | hypothetical protein | - |
| J5F47_RS13050 (J5F47_13060) | - | 2377146..2377796 (-) | 651 | WP_049142647.1 | hypothetical protein | - |
| J5F47_RS13055 (J5F47_13065) | - | 2377807..2378979 (-) | 1173 | WP_049142646.1 | phage tail tip lysozyme | - |
| J5F47_RS13060 (J5F47_13070) | - | 2378998..2379870 (-) | 873 | WP_049142645.1 | LPXTG cell wall anchor domain-containing protein | - |
| J5F47_RS13065 (J5F47_13075) | - | 2379892..2380812 (-) | 921 | WP_049142644.1 | hypothetical protein | - |
| J5F47_RS13070 (J5F47_13080) | - | 2380812..2381081 (-) | 270 | WP_049142643.1 | hypothetical protein | - |
| J5F47_RS13075 (J5F47_13085) | - | 2381078..2381458 (-) | 381 | WP_049142642.1 | DUF805 domain-containing protein | - |
| J5F47_RS13080 (J5F47_13090) | - | 2381925..2383388 (-) | 1464 | WP_049142641.1 | glucosaminidase domain-containing protein | - |
| J5F47_RS13085 (J5F47_13095) | - | 2383452..2386469 (-) | 3018 | WP_049142640.1 | SpaA isopeptide-forming pilin-related protein | - |
| J5F47_RS13090 (J5F47_13100) | - | 2386620..2387459 (-) | 840 | WP_049142639.1 | LysM domain-containing protein | - |
| J5F47_RS13095 (J5F47_13105) | - | 2387604..2387849 (+) | 246 | WP_049142638.1 | hypothetical protein | - |
| J5F47_RS13100 (J5F47_13110) | - | 2387912..2388334 (+) | 423 | WP_049142637.1 | hypothetical protein | - |
| J5F47_RS13105 (J5F47_13115) | - | 2388428..2388745 (-) | 318 | WP_049142636.1 | hypothetical protein | - |
| J5F47_RS13110 (J5F47_13120) | - | 2388772..2388978 (-) | 207 | WP_049142635.1 | hypothetical protein | - |
| J5F47_RS13115 (J5F47_13125) | - | 2388959..2389141 (-) | 183 | WP_049142634.1 | hypothetical protein | - |
| J5F47_RS13120 (J5F47_13130) | - | 2389155..2389505 (-) | 351 | WP_049142633.1 | hypothetical protein | - |
| J5F47_RS13125 (J5F47_13135) | - | 2389531..2389833 (-) | 303 | WP_049142632.1 | hypothetical protein | - |
| J5F47_RS13130 (J5F47_13140) | - | 2389836..2390069 (-) | 234 | WP_049142631.1 | hypothetical protein | - |
| J5F47_RS15550 | - | 2390973..2391503 (-) | 531 | WP_228394825.1 | hypothetical protein | - |
| J5F47_RS13140 (J5F47_13150) | - | 2391500..2392615 (-) | 1116 | WP_049142629.1 | replication initiator protein A | - |
| J5F47_RS13145 (J5F47_13155) | - | 2392621..2393019 (-) | 399 | WP_049142628.1 | replication initiator protein A | - |
| J5F47_RS13150 (J5F47_13160) | - | 2393729..2394682 (+) | 954 | WP_000222572.1 | IS30 family transposase | - |
| J5F47_RS13155 (J5F47_13165) | - | 2394679..2394825 (-) | 147 | WP_002321654.1 | EntF family bacteriocin induction factor | - |
| J5F47_RS13160 (J5F47_13170) | - | 2394929..2395240 (-) | 312 | WP_002287810.1 | bacteriocin immunity protein | - |
| J5F47_RS13165 (J5F47_13175) | - | 2395242..2395439 (-) | 198 | WP_002304799.1 | class II bacteriocin | - |
| J5F47_RS13170 (J5F47_13180) | - | 2395833..2397560 (-) | 1728 | WP_002287807.1 | ABC transporter permease/substrate binding protein | - |
| J5F47_RS13175 (J5F47_13185) | - | 2397553..2398746 (-) | 1194 | WP_002287805.1 | glycine betaine/L-proline ABC transporter ATP-binding protein | - |
| J5F47_RS13180 (J5F47_13190) | - | 2398933..2399577 (-) | 645 | WP_002287801.1 | GntR family transcriptional regulator | - |
| J5F47_RS13185 (J5F47_13195) | - | 2399671..2399805 (-) | 135 | WP_002290587.1 | hypothetical protein | - |
| J5F47_RS13190 (J5F47_13200) | feoB | 2399807..2401939 (-) | 2133 | WP_002287799.1 | ferrous iron transport protein B | - |
| J5F47_RS13195 (J5F47_13205) | - | 2401936..2402409 (-) | 474 | WP_002287797.1 | ferrous iron transport protein A | - |
| J5F47_RS13200 (J5F47_13210) | nrdH | 2402810..2403034 (+) | 225 | WP_002287795.1 | glutaredoxin-like protein NrdH | - |
| J5F47_RS13205 (J5F47_13215) | nrdE | 2403193..2405352 (+) | 2160 | WP_002287793.1 | class 1b ribonucleoside-diphosphate reductase subunit alpha | - |
| J5F47_RS13210 (J5F47_13220) | nrdF | 2405402..2406367 (+) | 966 | WP_002287792.1 | class 1b ribonucleoside-diphosphate reductase subunit beta | - |
| J5F47_RS13215 (J5F47_13225) | - | 2406456..2407595 (-) | 1140 | WP_002287791.1 | AI-2E family transporter | - |
Sequence
Protein
Download Length: 139 a.a. Molecular weight: 15682.65 Da Isoelectric Point: 9.2337
>NTDB_id=549184 J5F47_RS12990 WP_049142657.1 2363992..2364411(-) (ssb) [Enterococcus faecium strain VRE3355]
MMNSVNLVGRLTKEVDLKYTPKGNATGTFILAVNRNYTNANGEREADYIRCVIWRKAAETLAKYTGKGSLIGINGRLQTR
SYQNQQGQTMYVTEVLVTDFYLLESKEINEQRSKSMANNQNNSSIPGNEIQISDSYLPF
MMNSVNLVGRLTKEVDLKYTPKGNATGTFILAVNRNYTNANGEREADYIRCVIWRKAAETLAKYTGKGSLIGINGRLQTR
SYQNQQGQTMYVTEVLVTDFYLLESKEINEQRSKSMANNQNNSSIPGNEIQISDSYLPF
Nucleotide
Download Length: 420 bp
>NTDB_id=549184 J5F47_RS12990 WP_049142657.1 2363992..2364411(-) (ssb) [Enterococcus faecium strain VRE3355]
ATGATGAATTCAGTGAATTTAGTAGGACGGTTAACAAAAGAAGTGGATTTAAAATACACACCAAAAGGCAATGCGACAGG
CACATTTATTTTAGCTGTTAATCGAAATTATACGAATGCAAACGGCGAGCGTGAAGCAGATTATATCCGCTGTGTCATTT
GGCGGAAAGCTGCGGAAACTTTAGCAAAATATACTGGAAAAGGAAGTTTGATTGGCATTAATGGACGTCTTCAAACGAGG
AGCTATCAGAATCAGCAAGGACAGACCATGTATGTTACGGAAGTTCTAGTGACAGATTTCTATTTGTTAGAGAGTAAAGA
AATCAATGAGCAACGGTCAAAATCAATGGCGAATAATCAAAATAATTCTTCAATTCCAGGAAATGAGATTCAAATTTCAG
ATAGTTATTTGCCCTTTTAA
ATGATGAATTCAGTGAATTTAGTAGGACGGTTAACAAAAGAAGTGGATTTAAAATACACACCAAAAGGCAATGCGACAGG
CACATTTATTTTAGCTGTTAATCGAAATTATACGAATGCAAACGGCGAGCGTGAAGCAGATTATATCCGCTGTGTCATTT
GGCGGAAAGCTGCGGAAACTTTAGCAAAATATACTGGAAAAGGAAGTTTGATTGGCATTAATGGACGTCTTCAAACGAGG
AGCTATCAGAATCAGCAAGGACAGACCATGTATGTTACGGAAGTTCTAGTGACAGATTTCTATTTGTTAGAGAGTAAAGA
AATCAATGAGCAACGGTCAAAATCAATGGCGAATAATCAAAATAATTCTTCAATTCCAGGAAATGAGATTCAAATTTCAG
ATAGTTATTTGCCCTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.765 |
100 |
0.633 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
43.023 |
100 |
0.532 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
44.604 |
100 |
0.446 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
43.885 |
100 |
0.439 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
43.885 |
100 |
0.439 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
43.885 |
100 |
0.439 |
| ssbB/cilA | Streptococcus mitis SK321 |
43.885 |
100 |
0.439 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
43.885 |
100 |
0.439 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
54.717 |
76.259 |
0.417 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
41.007 |
100 |
0.41 |
| ssbA | Streptococcus mutans UA159 |
41.007 |
100 |
0.41 |