Detailed information NTG0546928

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: LP473_RS10775
• Genome accession: NZ_CP087699
• Coordinates: 2155913..2156182 (-)
• Length: 89 a.a.
• NCBI ID: WP_003129998.1
• Uniprot ID: -
• Organism: Lactococcus lactis subsp. lactis strain IBB417
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2150913..2161182

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LP473_RS10735 (LP473_10740)	-	2151432..2152241 (-)	810	WP_014570791.1	metal ABC transporter permease	-
LP473_RS10740 (LP473_10745)	-	2152234..2152971 (-)	738	WP_058221575.1	metal ABC transporter ATP-binding protein	-
LP473_RS10745 (LP473_10750)	-	2153148..2153990 (-)	843	WP_003129990.1	metal ABC transporter substrate-binding protein	-
LP473_RS10750 (LP473_10755)	-	2153987..2154424 (-)	438	WP_003129992.1	zinc-dependent MarR family transcriptional regulator	-
LP473_RS10755 (LP473_10760)	comGG	2154522..2154806 (-)	285	WP_003129993.1	competence type IV pilus minor pilin ComGG	Machinery gene
LP473_RS10760 (LP473_10765)	comGF	2154845..2155291 (-)	447	WP_029344525.1	competence type IV pilus minor pilin ComGF	Machinery gene
LP473_RS10765 (LP473_10770)	comGE	2155254..2155550 (-)	297	WP_010906316.1	competence type IV pilus minor pilin ComGE	Machinery gene
LP473_RS10770 (LP473_10775)	comGD	2155522..2155953 (-)	432	WP_080585155.1	competence type IV pilus minor pilin ComGD	Machinery gene
LP473_RS10775 (LP473_10780)	comGC	2155913..2156182 (-)	270	WP_003129998.1	competence type IV pilus major pilin ComGC	Machinery gene
LP473_RS10780 (LP473_10785)	-	2156288..2157007 (-)	720	WP_095345449.1	hypothetical protein	-
LP473_RS10785 (LP473_10790)	-	2157087..2157866 (-)	780	WP_252174746.1	peptidoglycan amidohydrolase family protein	-
LP473_RS10790 (LP473_10795)	-	2157866..2158165 (-)	300	WP_252174747.1	phage holin	-
LP473_RS10795 (LP473_10800)	-	2158178..2158528 (-)	351	WP_014570798.1	hypothetical protein	-
LP473_RS10800 (LP473_10805)	-	2158541..2158777 (-)	237	WP_081196280.1	hypothetical protein	-
LP473_RS10805 (LP473_10810)	-	2158789..2160567 (-)	1779	WP_252174748.1	hypothetical protein	-
LP473_RS10810 (LP473_10815)	-	2160545..2160718 (-)	174	WP_252174749.1	hypothetical protein	-

Sequence

Protein

• Length: 89 a.a.
• Molecular weight: 10123.56 Da
• Isoelectric Point: 4.2950

>NTDB_id=546928 LP473_RS10775 WP_003129998.1 2155913..2156182(-) (comGC) [Lactococcus lactis subsp. lactis strain IBB417]
MLIVLAIISILILLFVPNLIKEKSQVQKTGEAAVVKVVESQAQLYELDHDDEKPSLPELLSAGMITQKQISAYDNYYDQN
KNEERNFND

Nucleotide

• Length: 270 bp

>NTDB_id=546928 LP473_RS10775 WP_003129998.1 2155913..2156182(-) (comGC) [Lactococcus lactis subsp. lactis strain IBB417]
ATGTTAATTGTACTAGCTATTATTAGTATTTTAATATTACTATTTGTTCCAAATTTAATTAAAGAAAAATCACAAGTTCA
AAAAACTGGAGAAGCGGCAGTTGTAAAAGTAGTAGAAAGTCAAGCTCAACTTTATGAATTAGATCATGATGATGAGAAGC
CGAGTCTGCCAGAATTGCTCAGCGCTGGGATGATTACTCAAAAACAAATTTCTGCTTACGATAATTACTATGATCAGAAC
AAAAATGAAGAACGAAATTTTAATGACTAG

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Lactococcus lactis subsp. cremoris KW2	86.667	84.27	0.73
comGC/cglC	Streptococcus pneumoniae Rx1	55.056	100	0.551
comGC/cglC	Streptococcus pneumoniae D39	55.056	100	0.551
comGC/cglC	Streptococcus pneumoniae R6	55.056	100	0.551
comGC/cglC	Streptococcus pneumoniae TIGR4	55.056	100	0.551
comGC	Streptococcus gordonii str. Challis substr. CH1	56.471	95.506	0.539
comGC	Streptococcus suis isolate S10	58.904	82.022	0.483
comGC/cglC	Streptococcus mitis SK321	53.947	85.393	0.461
comGC	Streptococcus mutans UA140	50.685	82.022	0.416
comGC	Streptococcus mutans UA159	50.685	82.022	0.416
comGC/cglC	Streptococcus mitis NCTC 12261	56.25	71.91	0.404