Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   LP473_RS10755 Genome accession   NZ_CP087699
Coordinates   2154522..2154806 (-) Length   94 a.a.
NCBI ID   WP_003129993.1    Uniprot ID   -
Organism   Lactococcus lactis subsp. lactis strain IBB417     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2149522..2159806
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LP473_RS10725 (LP473_10730) - 2149946..2150323 (-) 378 WP_003129983.1 pyridoxamine 5'-phosphate oxidase family protein -
  LP473_RS10730 (LP473_10735) - 2150527..2151393 (+) 867 WP_153927515.1 RluA family pseudouridine synthase -
  LP473_RS10735 (LP473_10740) - 2151432..2152241 (-) 810 WP_014570791.1 metal ABC transporter permease -
  LP473_RS10740 (LP473_10745) - 2152234..2152971 (-) 738 WP_058221575.1 metal ABC transporter ATP-binding protein -
  LP473_RS10745 (LP473_10750) - 2153148..2153990 (-) 843 WP_003129990.1 metal ABC transporter substrate-binding protein -
  LP473_RS10750 (LP473_10755) - 2153987..2154424 (-) 438 WP_003129992.1 zinc-dependent MarR family transcriptional regulator -
  LP473_RS10755 (LP473_10760) comGG 2154522..2154806 (-) 285 WP_003129993.1 competence type IV pilus minor pilin ComGG Machinery gene
  LP473_RS10760 (LP473_10765) comGF 2154845..2155291 (-) 447 WP_029344525.1 competence type IV pilus minor pilin ComGF Machinery gene
  LP473_RS10765 (LP473_10770) comGE 2155254..2155550 (-) 297 WP_010906316.1 competence type IV pilus minor pilin ComGE Machinery gene
  LP473_RS10770 (LP473_10775) comGD 2155522..2155953 (-) 432 WP_080585155.1 competence type IV pilus minor pilin ComGD Machinery gene
  LP473_RS10775 (LP473_10780) comGC 2155913..2156182 (-) 270 WP_003129998.1 competence type IV pilus major pilin ComGC Machinery gene
  LP473_RS10780 (LP473_10785) - 2156288..2157007 (-) 720 WP_095345449.1 hypothetical protein -
  LP473_RS10785 (LP473_10790) - 2157087..2157866 (-) 780 WP_252174746.1 peptidoglycan amidohydrolase family protein -
  LP473_RS10790 (LP473_10795) - 2157866..2158165 (-) 300 WP_252174747.1 phage holin -
  LP473_RS10795 (LP473_10800) - 2158178..2158528 (-) 351 WP_014570798.1 hypothetical protein -
  LP473_RS10800 (LP473_10805) - 2158541..2158777 (-) 237 WP_081196280.1 hypothetical protein -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10783.02 Da        Isoelectric Point: 5.0604

>NTDB_id=546924 LP473_RS10755 WP_003129993.1 2154522..2154806(-) (comGG) [Lactococcus lactis subsp. lactis strain IBB417]
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDENTYQF
SIHLKDGANFQIKK

Nucleotide


Download         Length: 285 bp        

>NTDB_id=546924 LP473_RS10755 WP_003129993.1 2154522..2154806(-) (comGG) [Lactococcus lactis subsp. lactis strain IBB417]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAATACCTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

58.511

100

0.585