Detailed information
Bioinformatically predicted
Overview
| Name | comE/blpR | Type | Regulator |
| Locus tag | SDSE_RS13165 | Genome accession | NC_019042 |
| Coordinates | 487758..488507 (+) | Length | 249 a.a. |
| NCBI ID | WP_015057380.1 | Uniprot ID | A0AB33R540 |
| Organism | Streptococcus dysgalactiae subsp. equisimilis AC-2713 | ||
| Function | activate transcription of early competence genes; regulation of comX expression (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 427233..510009 | 487758..488507 | within | 0 |
| IScluster/Tn | 486404..487510 | 487758..488507 | flank | 248 |
Gene organization within MGE regions
Location: 427233..510009
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SDSE_RS12865 (S_dysgal_equisimilis_AC2713_488) | rsmI | 427491..428354 (+) | 864 | WP_003058668.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
| SDSE_RS12870 (S_dysgal_equisimilis_AC2713_489) | - | 428381..428773 (+) | 393 | WP_003058684.1 | DUF5684 domain-containing protein | - |
| SDSE_RS12875 (S_dysgal_equisimilis_AC2713_490) | - | 428820..429449 (-) | 630 | WP_003058655.1 | copper homeostasis protein CutC | - |
| SDSE_RS12880 (S_dysgal_equisimilis_AC2713_491) | serC | 429566..430657 (+) | 1092 | WP_015057358.1 | 3-phosphoserine/phosphohydroxythreonine transaminase | - |
| SDSE_RS12885 (S_dysgal_equisimilis_AC2713_492) | - | 430683..431234 (+) | 552 | WP_003058661.1 | GNAT family N-acetyltransferase | - |
| SDSE_RS12890 (S_dysgal_equisimilis_AC2713_493) | - | 431295..431792 (+) | 498 | WP_003058665.1 | methylated-DNA--[protein]-cysteine S-methyltransferase | - |
| SDSE_RS12895 (S_dysgal_equisimilis_AC2713_494) | - | 431789..432145 (+) | 357 | WP_003058672.1 | arsenate reductase family protein | - |
| SDSE_RS12900 (S_dysgal_equisimilis_AC2713_495) | - | 432197..432505 (-) | 309 | WP_003058659.1 | VOC family protein | - |
| SDSE_RS12905 (S_dysgal_equisimilis_AC2713_496) | - | 432507..432896 (-) | 390 | WP_003058670.1 | glyoxalase/bleomycin resistance/extradiol dioxygenase family protein | - |
| SDSE_RS12910 (S_dysgal_equisimilis_AC2713_497) | - | 433058..433885 (-) | 828 | WP_003058681.1 | exodeoxyribonuclease III | - |
| SDSE_RS12915 (S_dysgal_equisimilis_AC2713_498) | - | 434174..434806 (+) | 633 | WP_003055618.1 | SdpI family protein | - |
| SDSE_RS12920 (S_dysgal_equisimilis_AC2713_500) | - | 435113..436633 (+) | 1521 | WP_003055619.1 | lactate permease LctP family transporter | - |
| SDSE_RS12925 (S_dysgal_equisimilis_AC2713_501) | lctO | 436775..437956 (+) | 1182 | WP_003055631.1 | L-lactate oxidase | - |
| SDSE_RS21650 | - | 438208..442958 (+) | 4751 | Protein_410 | S8 family serine peptidase | - |
| SDSE_RS12935 (S_dysgal_equisimilis_AC2713_505) | - | 443171..444838 (+) | 1668 | WP_015057361.1 | hypothetical protein | - |
| SDSE_RS12940 (S_dysgal_equisimilis_AC2713_506) | - | 445121..445828 (+) | 708 | WP_014612064.1 | YoaK family protein | - |
| SDSE_RS12945 (S_dysgal_equisimilis_AC2713_507) | metG | 446096..448093 (+) | 1998 | WP_003055633.1 | methionine--tRNA ligase | - |
| SDSE_RS12950 (S_dysgal_equisimilis_AC2713_508) | nrdF | 448626..449639 (+) | 1014 | WP_003055629.1 | class 1b ribonucleoside-diphosphate reductase subunit beta | - |
| SDSE_RS12955 (S_dysgal_equisimilis_AC2713_509) | nrdI | 449643..450116 (+) | 474 | WP_014612066.1 | class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI | - |
| SDSE_RS12960 (S_dysgal_equisimilis_AC2713_510) | nrdE | 450100..452286 (+) | 2187 | WP_015057363.1 | class 1b ribonucleoside-diphosphate reductase subunit alpha | - |
| SDSE_RS12965 (S_dysgal_equisimilis_AC2713_511) | brnQ | 452584..453918 (+) | 1335 | WP_015057364.1 | branched-chain amino acid transport system II carrier protein | - |
| SDSE_RS12970 (S_dysgal_equisimilis_AC2713_512) | - | 454317..454670 (+) | 354 | WP_015057365.1 | hypothetical protein | - |
| SDSE_RS12975 (S_dysgal_equisimilis_AC2713_514) | - | 455019..455255 (+) | 237 | WP_003054401.1 | DUF2829 domain-containing protein | - |
| SDSE_RS12980 (S_dysgal_equisimilis_AC2713_515) | - | 455248..455946 (+) | 699 | WP_003054338.1 | 3-oxoacyl-ACP reductase | - |
| SDSE_RS12985 (S_dysgal_equisimilis_AC2713_516) | - | 455943..456185 (+) | 243 | WP_003054367.1 | DUF3977 family protein | - |
| SDSE_RS12990 (S_dysgal_equisimilis_AC2713_517) | - | 456203..456652 (+) | 450 | WP_014612070.1 | ASCH domain-containing protein | - |
| SDSE_RS12995 (S_dysgal_equisimilis_AC2713_518) | - | 456654..457613 (+) | 960 | WP_003054341.1 | Gfo/Idh/MocA family oxidoreductase | - |
| SDSE_RS13000 (S_dysgal_equisimilis_AC2713_519) | - | 457947..459284 (+) | 1338 | WP_003054334.1 | MFS transporter | - |
| SDSE_RS13005 (S_dysgal_equisimilis_AC2713_520) | glmU | 459403..460785 (+) | 1383 | WP_003061627.1 | bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU | - |
| SDSE_RS13010 (S_dysgal_equisimilis_AC2713_521) | - | 460816..461370 (+) | 555 | WP_003054386.1 | NUDIX hydrolase | - |
| SDSE_RS13015 (S_dysgal_equisimilis_AC2713_522) | macP | 461371..461622 (+) | 252 | WP_003054365.1 | cell wall synthase accessory phosphoprotein MacP | - |
| SDSE_RS13020 (S_dysgal_equisimilis_AC2713_523) | - | 461640..462335 (+) | 696 | WP_015057367.1 | 5'-methylthioadenosine/adenosylhomocysteine nucleosidase | - |
| SDSE_RS13025 (S_dysgal_equisimilis_AC2713_524) | - | 462408..463055 (-) | 648 | WP_003054353.1 | metal-dependent transcriptional regulator | - |
| SDSE_RS13030 (S_dysgal_equisimilis_AC2713_525) | - | 463201..464133 (+) | 933 | WP_003054333.1 | metal ABC transporter substrate-binding protein | - |
| SDSE_RS13035 (S_dysgal_equisimilis_AC2713_526) | - | 464198..464923 (+) | 726 | WP_003054363.1 | metal ABC transporter ATP-binding protein | - |
| SDSE_RS13040 (S_dysgal_equisimilis_AC2713_527) | - | 464924..465772 (+) | 849 | WP_003054335.1 | metal ABC transporter permease | - |
| SDSE_RS13045 (S_dysgal_equisimilis_AC2713_528) | - | 465903..466709 (-) | 807 | WP_003054349.1 | peptidylprolyl isomerase | - |
| SDSE_RS13050 (S_dysgal_equisimilis_AC2713_529) | - | 466927..469335 (+) | 2409 | WP_037587270.1 | DNA translocase FtsK | - |
| SDSE_RS13055 (S_dysgal_equisimilis_AC2713_530) | - | 469404..469757 (-) | 354 | WP_012766635.1 | DUF3397 domain-containing protein | - |
| SDSE_RS13060 (S_dysgal_equisimilis_AC2713_531) | rplK | 470000..470425 (+) | 426 | WP_003049875.1 | 50S ribosomal protein L11 | - |
| SDSE_RS13065 (S_dysgal_equisimilis_AC2713_532) | rplA | 470531..471220 (+) | 690 | WP_003049876.1 | 50S ribosomal protein L1 | - |
| SDSE_RS22015 (S_dysgal_equisimilis_AC2713_533) | - | 471495..471629 (-) | 135 | WP_003061219.1 | hypothetical protein | - |
| SDSE_RS21755 (SDSE_0518) | - | 471678..471845 (-) | 168 | WP_003054374.1 | hypothetical protein | - |
| SDSE_RS13070 (S_dysgal_equisimilis_AC2713_534) | pyrH | 472113..472841 (+) | 729 | WP_003049878.1 | UMP kinase | - |
| SDSE_RS13075 (S_dysgal_equisimilis_AC2713_535) | frr | 472870..473427 (+) | 558 | WP_003054381.1 | ribosome recycling factor | - |
| SDSE_RS13080 (S_dysgal_equisimilis_AC2713_536) | - | 473547..474404 (+) | 858 | WP_015057368.1 | S1 RNA-binding domain-containing protein | - |
| SDSE_RS13085 (S_dysgal_equisimilis_AC2713_537) | msrA | 474477..474986 (+) | 510 | WP_015057369.1 | peptide-methionine (S)-S-oxide reductase MsrA | - |
| SDSE_RS13090 (S_dysgal_equisimilis_AC2713_538) | - | 474983..475198 (+) | 216 | WP_003060598.1 | YozE family protein | - |
| SDSE_RS13095 (S_dysgal_equisimilis_AC2713_539) | - | 475337..476521 (+) | 1185 | WP_015057370.1 | LysM domain-containing protein | - |
| SDSE_RS13100 (S_dysgal_equisimilis_AC2713_540) | - | 476832..478604 (+) | 1773 | WP_015057371.1 | oleate hydratase | - |
| SDSE_RS13105 (S_dysgal_equisimilis_AC2713_542) | - | 478765..479826 (+) | 1062 | WP_015057372.1 | PhoH family protein | - |
| SDSE_RS13110 (S_dysgal_equisimilis_AC2713_543) | - | 479873..480448 (+) | 576 | WP_015057373.1 | uracil-DNA glycosylase family protein | - |
| SDSE_RS13115 (S_dysgal_equisimilis_AC2713_544) | ybeY | 480607..481104 (+) | 498 | WP_003054373.1 | rRNA maturation RNase YbeY | - |
| SDSE_RS13120 (S_dysgal_equisimilis_AC2713_545) | - | 481085..481492 (+) | 408 | WP_003054389.1 | diacylglycerol kinase | - |
| SDSE_RS13125 (S_dysgal_equisimilis_AC2713_546) | era | 481613..482509 (+) | 897 | WP_012766643.1 | GTPase Era | - |
| SDSE_RS21875 | - | 482696..483002 (+) | 307 | Protein_452 | NUDIX domain-containing protein | - |
| SDSE_RS13130 (S_dysgal_equisimilis_AC2713_547) | - | 482980..484239 (-) | 1260 | Protein_453 | ABC transporter transmembrane domain-containing protein | - |
| SDSE_RS13135 (S_dysgal_equisimilis_AC2713_548) | - | 484543..484770 (+) | 228 | WP_003062179.1 | hypothetical protein | - |
| SDSE_RS13140 (S_dysgal_equisimilis_AC2713_549) | - | 484819..485136 (+) | 318 | WP_002994587.1 | hypothetical protein | - |
| SDSE_RS13145 (S_dysgal_equisimilis_AC2713_550) | - | 485520..485783 (+) | 264 | WP_255306607.1 | Blp family class II bacteriocin | - |
| SDSE_RS13150 (SDSE_0537) | - | 485797..485982 (+) | 186 | WP_003054392.1 | hypothetical protein | - |
| SDSE_RS13155 | - | 486404..487510 (-) | 1107 | Protein_458 | IS3 family transposase | - |
| SDSE_RS13165 (S_dysgal_equisimilis_AC2713_554) | comE/blpR | 487758..488507 (+) | 750 | WP_015057380.1 | response regulator transcription factor | Regulator |
| SDSE_RS13170 (S_dysgal_equisimilis_AC2713_555) | - | 488508..489842 (+) | 1335 | WP_015057381.1 | GHKL domain-containing protein | - |
| SDSE_RS21375 (S_dysgal_equisimilis_AC2713_556) | - | 489990..490115 (-) | 126 | WP_011017462.1 | ComC/BlpC family leader-containing pheromone/bacteriocin | - |
| SDSE_RS13175 (S_dysgal_equisimilis_AC2713_557) | - | 490192..491556 (-) | 1365 | WP_015057382.1 | bacteriocin secretion accessory protein | - |
| SDSE_RS13180 (S_dysgal_equisimilis_AC2713_559) | - | 491567..493720 (-) | 2154 | Protein_463 | peptide cleavage/export ABC transporter | - |
| SDSE_RS13185 (S_dysgal_equisimilis_AC2713_560) | - | 494001..494225 (+) | 225 | WP_015057385.1 | ComC/BlpC family leader-containing pheromone/bacteriocin | - |
| SDSE_RS13190 (S_dysgal_equisimilis_AC2713_561) | - | 494248..494580 (+) | 333 | WP_015057386.1 | hypothetical protein | - |
| SDSE_RS13195 (S_dysgal_equisimilis_AC2713_562) | - | 494650..495513 (+) | 864 | WP_003059989.1 | IS982 family transposase | - |
| SDSE_RS13200 (SDSE_0550) | - | 495771..496181 (+) | 411 | WP_015057387.1 | hypothetical protein | - |
| SDSE_RS21840 | - | 496428..496675 (+) | 248 | Protein_468 | hypothetical protein | - |
| SDSE_RS21380 (SDSE_0552) | - | 496697..496951 (+) | 255 | WP_014612089.1 | CPBP family intramembrane glutamic endopeptidase | - |
| SDSE_RS13205 (S_dysgal_equisimilis_AC2713_564) | - | 497247..498044 (+) | 798 | WP_015057389.1 | hypothetical protein | - |
| SDSE_RS13210 | - | 498241..499169 (-) | 929 | Protein_471 | hypothetical protein | - |
| SDSE_RS21660 | - | 499238..499306 (-) | 69 | WP_138128264.1 | SHP2/SHP3 family peptide pheromone | - |
| SDSE_RS13215 (S_dysgal_equisimilis_AC2713_567) | rgg2 | 499396..500250 (+) | 855 | WP_014612092.1 | quorum-sensing system transcriptional regulator Rgg2 | - |
| SDSE_RS13220 (S_dysgal_equisimilis_AC2713_568) | mutM | 500432..501259 (+) | 828 | WP_014612093.1 | DNA-formamidopyrimidine glycosylase | - |
| SDSE_RS13225 (S_dysgal_equisimilis_AC2713_569) | coaE | 501238..501849 (+) | 612 | WP_014612094.1 | dephospho-CoA kinase | - |
| SDSE_RS13230 (S_dysgal_equisimilis_AC2713_570) | - | 502310..503011 (+) | 702 | WP_003056868.1 | ABC transporter ATP-binding protein | - |
| SDSE_RS13235 (S_dysgal_equisimilis_AC2713_571) | - | 503001..504638 (+) | 1638 | WP_015057392.1 | hypothetical protein | - |
| SDSE_RS13240 (S_dysgal_equisimilis_AC2713_572) | - | 504748..506250 (+) | 1503 | WP_003055193.1 | helicase HerA-like domain-containing protein | - |
| SDSE_RS13250 (S_dysgal_equisimilis_AC2713_573) | - | 506414..507631 (+) | 1218 | WP_223846048.1 | multidrug efflux MFS transporter | - |
| SDSE_RS21385 (S_dysgal_equisimilis_AC2713_574) | rpmG | 507628..507774 (+) | 147 | WP_003047126.1 | 50S ribosomal protein L33 | - |
| SDSE_RS13255 (S_dysgal_equisimilis_AC2713_575) | secG | 507820..508056 (+) | 237 | WP_003047129.1 | preprotein translocase subunit SecG | - |
Sequence
Protein
Download Length: 249 a.a. Molecular weight: 29137.45 Da Isoelectric Point: 5.8302
>NTDB_id=54295 SDSE_RS13165 WP_015057380.1 487758..488507(+) (comE/blpR) [Streptococcus dysgalactiae subsp. equisimilis AC-2713]
MNIFVLEDDFLHQTRIEKIIYKILTDNKLEVNHLEVYGKPNQLLEDISERGRHQLFFLDIDIKGEDKKGMEIAVEIRNKD
PHAVIVFVTTHSEFMPVSFQYQVSALDFIDKELPEELFSHRIEKAISYVQDNQGKTLAEDSFVFTNVKSQIQVPFSDLLY
IETSLIPHKLILYSTKQRVEFYGQLSEIVEQDDRLFQCHRSFVVNPYNISSIDRSERLVYLKGGLSCIVSRLKIRSLIKV
VEELHTKEK
MNIFVLEDDFLHQTRIEKIIYKILTDNKLEVNHLEVYGKPNQLLEDISERGRHQLFFLDIDIKGEDKKGMEIAVEIRNKD
PHAVIVFVTTHSEFMPVSFQYQVSALDFIDKELPEELFSHRIEKAISYVQDNQGKTLAEDSFVFTNVKSQIQVPFSDLLY
IETSLIPHKLILYSTKQRVEFYGQLSEIVEQDDRLFQCHRSFVVNPYNISSIDRSERLVYLKGGLSCIVSRLKIRSLIKV
VEELHTKEK
Nucleotide
Download Length: 750 bp
>NTDB_id=54295 SDSE_RS13165 WP_015057380.1 487758..488507(+) (comE/blpR) [Streptococcus dysgalactiae subsp. equisimilis AC-2713]
ATGAATATTTTTGTCTTAGAGGACGATTTTTTACATCAAACCAGAATTGAAAAAATTATTTATAAGATTTTGACTGATAA
TAAGTTGGAGGTTAACCACTTGGAAGTTTATGGTAAACCCAATCAGCTGCTTGAAGATATATCAGAGAGAGGAAGACATC
AGCTTTTTTTTCTTGACATTGACATTAAGGGAGAAGATAAAAAAGGAATGGAAATTGCTGTGGAGATTAGAAATAAAGAT
CCGCACGCAGTGATAGTTTTTGTGACCACACATTCAGAATTTATGCCGGTATCTTTTCAATACCAGGTTTCAGCTTTAGA
CTTTATTGACAAAGAGTTGCCAGAGGAGTTATTTAGTCATCGCATTGAAAAAGCTATAAGTTATGTACAAGATAACCAAG
GAAAAACGTTAGCGGAGGATTCATTTGTTTTTACTAATGTAAAGTCCCAGATACAAGTCCCCTTTTCAGATTTGCTGTAT
ATTGAAACCTCACTAATTCCCCATAAACTCATTCTCTATTCTACTAAACAAAGAGTAGAATTTTATGGCCAATTATCAGA
AATTGTTGAGCAAGATGATCGATTATTTCAATGTCATCGTTCCTTTGTTGTTAATCCCTATAATATATCATCAATAGATA
GATCCGAACGGTTAGTTTATTTAAAGGGGGGATTATCTTGTATTGTTTCGAGATTGAAAATACGATCATTAATAAAAGTA
GTAGAAGAGTTGCACACTAAGGAGAAATAG
ATGAATATTTTTGTCTTAGAGGACGATTTTTTACATCAAACCAGAATTGAAAAAATTATTTATAAGATTTTGACTGATAA
TAAGTTGGAGGTTAACCACTTGGAAGTTTATGGTAAACCCAATCAGCTGCTTGAAGATATATCAGAGAGAGGAAGACATC
AGCTTTTTTTTCTTGACATTGACATTAAGGGAGAAGATAAAAAAGGAATGGAAATTGCTGTGGAGATTAGAAATAAAGAT
CCGCACGCAGTGATAGTTTTTGTGACCACACATTCAGAATTTATGCCGGTATCTTTTCAATACCAGGTTTCAGCTTTAGA
CTTTATTGACAAAGAGTTGCCAGAGGAGTTATTTAGTCATCGCATTGAAAAAGCTATAAGTTATGTACAAGATAACCAAG
GAAAAACGTTAGCGGAGGATTCATTTGTTTTTACTAATGTAAAGTCCCAGATACAAGTCCCCTTTTCAGATTTGCTGTAT
ATTGAAACCTCACTAATTCCCCATAAACTCATTCTCTATTCTACTAAACAAAGAGTAGAATTTTATGGCCAATTATCAGA
AATTGTTGAGCAAGATGATCGATTATTTCAATGTCATCGTTCCTTTGTTGTTAATCCCTATAATATATCATCAATAGATA
GATCCGAACGGTTAGTTTATTTAAAGGGGGGATTATCTTGTATTGTTTCGAGATTGAAAATACGATCATTAATAAAAGTA
GTAGAAGAGTTGCACACTAAGGAGAAATAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comE/blpR | Streptococcus mutans UA159 |
54.508 |
97.992 |
0.534 |
| comE/comE2 | Streptococcus gordonii strain NCTC7865 |
40.873 |
100 |
0.414 |
| comE/comE1 | Streptococcus gordonii str. Challis substr. CH1 |
40.873 |
100 |
0.414 |
| comE/comE1 | Streptococcus equinus JB1 |
42.437 |
95.582 |
0.406 |
| comE/comE2 | Streptococcus equinus JB1 |
40.984 |
97.992 |
0.402 |
| comE | Streptococcus mitis SK321 |
38.8 |
100 |
0.39 |
| comE | Streptococcus mitis NCTC 12261 |
38.8 |
100 |
0.39 |
| comE | Streptococcus pneumoniae TIGR4 |
38.4 |
100 |
0.386 |
| comE | Streptococcus pneumoniae Rx1 |
38.4 |
100 |
0.386 |
| comE | Streptococcus pneumoniae D39 |
38.4 |
100 |
0.386 |
| comE | Streptococcus pneumoniae R6 |
38.4 |
100 |
0.386 |
| comE | Streptococcus infantis strain Atu-4 |
38.306 |
99.598 |
0.382 |