Detailed information NTG0540320

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: LL046_RS11360
• Genome accession: NZ_CP086088
• Coordinates: 2219011..2219280 (-)
• Length: 89 a.a.
• NCBI ID: WP_023349160.1
• Uniprot ID: -
• Organism: Lactococcus lactis subsp. lactis strain EIP13A
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2214011..2224280

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LL046_RS11320 (LL046_11285)	-	2214547..2215356 (-)	810	WP_098403500.1	metal ABC transporter permease	-
LL046_RS11325 (LL046_11290)	-	2215349..2216086 (-)	738	WP_240819121.1	metal ABC transporter ATP-binding protein	-
LL046_RS11330 (LL046_11295)	-	2216263..2217105 (-)	843	WP_017865154.1	metal ABC transporter substrate-binding protein	-
LL046_RS11335 (LL046_11300)	-	2217102..2217539 (-)	438	WP_010906313.1	zinc-dependent MarR family transcriptional regulator	-
LL046_RS11340 (LL046_11305)	comGG	2217620..2217904 (-)	285	WP_017865155.1	competence type IV pilus minor pilin ComGG	Machinery gene
LL046_RS11345 (LL046_11310)	comGF	2217943..2218389 (-)	447	WP_032948129.1	competence type IV pilus minor pilin ComGF	Machinery gene
LL046_RS11350 (LL046_11315)	comGE	2218352..2218648 (-)	297	WP_017865157.1	competence type IV pilus minor pilin ComGE	Machinery gene
LL046_RS11355 (LL046_11320)	comGD	2218620..2219051 (-)	432	WP_026138965.1	competence type IV pilus minor pilin ComGD	Machinery gene
LL046_RS11360 (LL046_11325)	comGC	2219011..2219280 (-)	270	WP_023349160.1	competence type IV pilus major pilin ComGC	Machinery gene
LL046_RS11370 (LL046_11335)	-	2219863..2220642 (-)	780	WP_240819119.1	peptidoglycan amidohydrolase family protein	-
LL046_RS11375 (LL046_11340)	-	2220642..2220917 (-)	276	WP_240819117.1	holin	-
LL046_RS11380 (LL046_11345)	-	2220901..2221230 (-)	330	WP_240819115.1	hypothetical protein	-
LL046_RS11385 (LL046_11350)	-	2221243..2221479 (-)	237	WP_394535571.1	hypothetical protein	-
LL046_RS11390 (LL046_11355)	-	2221488..2223140 (-)	1653	WP_394535572.1	hypothetical protein	-
LL046_RS11395 (LL046_11360)	-	2223118..2223291 (-)	174	WP_240819270.1	hypothetical protein	-

Sequence

Protein

• Length: 89 a.a.
• Molecular weight: 10113.52 Da
• Isoelectric Point: 4.2950

>NTDB_id=540320 LL046_RS11360 WP_023349160.1 2219011..2219280(-) (comGC) [Lactococcus lactis subsp. lactis strain EIP13A]
MLIVLAIISILILLFVPNLIKEKSQVQKTGEAAVVKVVESQAQLYELDHDDEKPSLSELLSAGMITQKQISAYDNYYDQN
KNEERNFND

Nucleotide

• Length: 270 bp

>NTDB_id=540320 LL046_RS11360 WP_023349160.1 2219011..2219280(-) (comGC) [Lactococcus lactis subsp. lactis strain EIP13A]
ATGTTAATTGTACTAGCTATTATTAGTATTTTGATATTACTATTTGTTCCAAATTTAATTAAAGAAAAATCACAAGTTCA
AAAAACTGGAGAAGCGGCAGTTGTAAAAGTAGTAGAAAGTCAAGCTCAACTTTATGAATTAGATCATGATGATGAGAAGC
CGAGTCTGTCAGAATTGCTCAGCGCTGGGATGATTACTCAAAAACAAATTTCTGCTTACGATAATTACTATGATCAGAAT
AAAAATGAAGAACGAAATTTTAATGACTAG

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Lactococcus lactis subsp. cremoris KW2	88	84.27	0.742
comGC	Streptococcus gordonii str. Challis substr. CH1	57.647	95.506	0.551
comGC/cglC	Streptococcus pneumoniae Rx1	55.056	100	0.551
comGC/cglC	Streptococcus pneumoniae D39	55.056	100	0.551
comGC/cglC	Streptococcus pneumoniae R6	55.056	100	0.551
comGC/cglC	Streptococcus pneumoniae TIGR4	55.056	100	0.551
comGC	Streptococcus suis isolate S10	58.904	82.022	0.483
comGC/cglC	Streptococcus mitis SK321	55.263	85.393	0.472
comGC	Streptococcus mutans UA140	52.055	82.022	0.427
comGC	Streptococcus mutans UA159	52.055	82.022	0.427
comGC/cglC	Streptococcus mitis NCTC 12261	57.812	71.91	0.416