Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   LL046_RS11340 Genome accession   NZ_CP086088
Coordinates   2217620..2217904 (-) Length   94 a.a.
NCBI ID   WP_017865155.1    Uniprot ID   -
Organism   Lactococcus lactis subsp. lactis strain EIP13A     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2212620..2222904
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LL046_RS11310 (LL046_11275) - 2213060..2213437 (-) 378 WP_003129983.1 pyridoxamine 5'-phosphate oxidase family protein -
  LL046_RS11315 (LL046_11280) - 2213642..2214508 (+) 867 WP_058211147.1 RluA family pseudouridine synthase -
  LL046_RS11320 (LL046_11285) - 2214547..2215356 (-) 810 WP_098403500.1 metal ABC transporter permease -
  LL046_RS11325 (LL046_11290) - 2215349..2216086 (-) 738 WP_240819121.1 metal ABC transporter ATP-binding protein -
  LL046_RS11330 (LL046_11295) - 2216263..2217105 (-) 843 WP_017865154.1 metal ABC transporter substrate-binding protein -
  LL046_RS11335 (LL046_11300) - 2217102..2217539 (-) 438 WP_010906313.1 zinc-dependent MarR family transcriptional regulator -
  LL046_RS11340 (LL046_11305) comGG 2217620..2217904 (-) 285 WP_017865155.1 competence type IV pilus minor pilin ComGG Machinery gene
  LL046_RS11345 (LL046_11310) comGF 2217943..2218389 (-) 447 WP_032948129.1 competence type IV pilus minor pilin ComGF Machinery gene
  LL046_RS11350 (LL046_11315) comGE 2218352..2218648 (-) 297 WP_017865157.1 competence type IV pilus minor pilin ComGE Machinery gene
  LL046_RS11355 (LL046_11320) comGD 2218620..2219051 (-) 432 WP_026138965.1 competence type IV pilus minor pilin ComGD Machinery gene
  LL046_RS11360 (LL046_11325) comGC 2219011..2219280 (-) 270 WP_023349160.1 competence type IV pilus major pilin ComGC Machinery gene
  LL046_RS11370 (LL046_11335) - 2219863..2220642 (-) 780 WP_240819119.1 peptidoglycan amidohydrolase family protein -
  LL046_RS11375 (LL046_11340) - 2220642..2220917 (-) 276 WP_240819117.1 holin -
  LL046_RS11380 (LL046_11345) - 2220901..2221230 (-) 330 WP_240819115.1 hypothetical protein -
  LL046_RS11385 (LL046_11350) - 2221243..2221479 (-) 237 WP_394535571.1 hypothetical protein -

Sequence

Protein


Download         Length: 94 a.a.        Molecular weight: 10782.04 Da        Isoelectric Point: 5.5720

>NTDB_id=540316 LL046_RS11340 WP_017865155.1 2217620..2217904(-) (comGG) [Lactococcus lactis subsp. lactis strain EIP13A]
MFSMFLQFYLQRQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDEKTYQF
SIHLKDGANFQIKN

Nucleotide


Download         Length: 285 bp        

>NTDB_id=540316 LL046_RS11340 WP_017865155.1 2217620..2217904(-) (comGG) [Lactococcus lactis subsp. lactis strain EIP13A]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGCAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAAAACTTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAATTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

60.215

98.936

0.596