Detailed information NTG0532726

Bioinformatically predicted

Overview

• Name: ssbB
• Type: Machinery gene
• Locus tag: LLNCDO700_RS02045
• Genome accession: NZ_CP069179
• Coordinates: 401087..401476 (+)
• Length: 129 a.a.
• NCBI ID: WP_259692192.1
• Uniprot ID: -
• Organism: Lactococcus cremoris strain NCDO700
• Function: ssDNA binding (predicted from homology) DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Prophage	401087..410869	401087..401476	within	0

Gene organization within MGE regions

Location: 401087..410869

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LLNCDO700_RS02045 (LLNCDO700_02035)	ssbB	401087..401476 (+)	390	WP_259692192.1	single-stranded DNA-binding protein	Machinery gene
LLNCDO700_RS02050 (LLNCDO700_02040)	groES	401595..401879 (+)	285	WP_011834459.1	co-chaperone GroES	-
LLNCDO700_RS02055 (LLNCDO700_02045)	groL	401966..403594 (+)	1629	WP_011834460.1	chaperonin GroEL	-
LLNCDO700_RS02060 (LLNCDO700_02050)	-	403644..404456 (-)	813	WP_011675466.1	MBL fold metallo-hydrolase	-
LLNCDO700_RS02065 (LLNCDO700_02055)	-	404647..406074 (-)	1428	WP_011834461.1	cell wall metabolism sensor histidine kinase WalK	-
LLNCDO700_RS02070 (LLNCDO700_02060)	yycF	406067..406768 (-)	702	WP_259692191.1	response regulator YycF	-
LLNCDO700_RS02075 (LLNCDO700_02065)	tmk	406946..407581 (+)	636	WP_011834462.1	dTMP kinase	-
LLNCDO700_RS02080 (LLNCDO700_02070)	-	407714..408574 (+)	861	WP_011834463.1	DNA polymerase III subunit delta'	-
LLNCDO700_RS02085 (LLNCDO700_02075)	ricT	408624..409406 (+)	783	WP_011834464.1	stage 0 sporulation family protein	-
LLNCDO700_RS02090 (LLNCDO700_02080)	yabA	409399..409725 (+)	327	WP_011675472.1	DNA replication initiation control protein YabA	-
LLNCDO700_RS02095 (LLNCDO700_02085)	rsmI	409725..410600 (+)	876	WP_259692190.1	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	-
LLNCDO700_RS02100 (LLNCDO700_02090)	-	410678..410869 (-)	192	WP_011834467.1	hypothetical protein	-

Sequence

Protein

• Length: 129 a.a.
• Molecular weight: 14796.92 Da
• Isoelectric Point: 9.2952

>NTDB_id=532726 LLNCDO700_RS02045 WP_259692192.1 401087..401476(+) (ssbB) [Lactococcus cremoris strain NCDO700]
MNKTMLIGRLTNAPEISKTTNNKSYVRVTLAVNRRFKNEKGEREADFISIIIWRKSAETLVSYAKKGSLISVEGEIRTRN
YTDKNEQKHYITEILGLSYDLLESRATLALRESAVKTEELLLEADELPF

Nucleotide

• Length: 390 bp

>NTDB_id=532726 LLNCDO700_RS02045 WP_259692192.1 401087..401476(+) (ssbB) [Lactococcus cremoris strain NCDO700]
ATGAATAAAACCATGTTGATTGGTCGTTTAACAAACGCACCTGAAATTTCGAAAACAACGAACAATAAATCTTATGTCCG
TGTGACTCTGGCAGTCAATCGCCGCTTCAAAAATGAAAAAGGAGAGCGAGAAGCAGACTTTATCTCGATAATTATATGGA
GAAAATCAGCAGAAACATTGGTTTCCTATGCTAAAAAAGGAAGTCTTATTTCTGTAGAGGGAGAGATTAGAACTAGAAAT
TATACTGATAAAAATGAACAGAAACACTATATTACAGAAATCTTAGGTTTGAGCTATGATTTATTGGAAAGTCGTGCGAC
TCTTGCCTTGAGAGAAAGCGCTGTAAAGACTGAGGAACTCTTACTTGAAGCTGATGAGCTCCCTTTCTGA

Domains

Predicted by InterproScan.

• Single-strand binding protein family (SSB) (1-95)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
ssbB	Lactococcus lactis subsp. cremoris KW2	98.45	100	0.985
ssbB	Streptococcus sobrinus strain NIDR 6715-7	60.769	100	0.612
ssbB/cilA	Streptococcus pneumoniae TIGR4	56.154	100	0.566
ssbB/cilA	Streptococcus pneumoniae Rx1	55.385	100	0.558
ssbB/cilA	Streptococcus pneumoniae D39	55.385	100	0.558
ssbB/cilA	Streptococcus pneumoniae R6	55.385	100	0.558
ssbB/cilA	Streptococcus mitis NCTC 12261	55.385	100	0.558
ssbB/cilA	Streptococcus mitis SK321	55.385	100	0.558
ssbA	Streptococcus mutans UA159	53.846	100	0.543
ssb	Latilactobacillus sakei subsp. sakei 23K	40.833	93.023	0.38
ssbA	Bacillus subtilis subsp. subtilis str. 168	44.762	81.395	0.364