Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | JN168_RS09290 | Genome accession | NZ_CP069082 |
| Coordinates | 1971302..1971745 (-) | Length | 147 a.a. |
| NCBI ID | WP_279525824.1 | Uniprot ID | - |
| Organism | Staphylococcus gallinarum strain STP534 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1937335..1977109 | 1971302..1971745 | within | 0 |
Gene organization within MGE regions
Location: 1937335..1977109
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JN168_RS09040 | - | 1937335..1938753 (-) | 1419 | WP_279525795.1 | SH3 domain-containing protein | - |
| JN168_RS09045 | - | 1938753..1939064 (-) | 312 | WP_279526273.1 | phage holin | - |
| JN168_RS09050 | - | 1939224..1939595 (-) | 372 | WP_232153929.1 | DUF2951 family protein | - |
| JN168_RS09055 | - | 1939633..1939782 (-) | 150 | WP_279525796.1 | XkdX family protein | - |
| JN168_RS09060 | - | 1939784..1940173 (-) | 390 | WP_119472648.1 | hypothetical protein | - |
| JN168_RS09065 | - | 1940188..1941675 (-) | 1488 | WP_119472647.1 | BppU family phage baseplate upper protein | - |
| JN168_RS09070 | - | 1941689..1944346 (-) | 2658 | WP_279525797.1 | peptidase G2 autoproteolytic cleavage domain-containing protein | - |
| JN168_RS09075 | - | 1944363..1944827 (-) | 465 | WP_042738340.1 | hypothetical protein | - |
| JN168_RS09080 | - | 1944820..1946406 (-) | 1587 | WP_279525798.1 | prophage endopeptidase tail family protein | - |
| JN168_RS09085 | - | 1946416..1947243 (-) | 828 | WP_279525799.1 | distal tail protein Dit | - |
| JN168_RS09090 | - | 1947245..1951600 (-) | 4356 | WP_279525800.1 | peptidoglycan DD-metalloendopeptidase family protein | - |
| JN168_RS09095 | - | 1951630..1952148 (-) | 519 | WP_279526280.1 | phage tail assembly chaperone GT | - |
| JN168_RS09100 | - | 1952164..1952523 (-) | 360 | WP_107590298.1 | phage tail assembly chaperone G | - |
| JN168_RS09105 | - | 1952593..1952778 (-) | 186 | WP_107579406.1 | hypothetical protein | - |
| JN168_RS09110 | - | 1952798..1953436 (-) | 639 | WP_107579405.1 | major tail protein | - |
| JN168_RS09115 | - | 1953449..1953853 (-) | 405 | WP_107590300.1 | hypothetical protein | - |
| JN168_RS09120 | - | 1953856..1954260 (-) | 405 | WP_107579403.1 | hypothetical protein | - |
| JN168_RS09125 | - | 1954257..1954586 (-) | 330 | WP_107579402.1 | hypothetical protein | - |
| JN168_RS09130 | - | 1954576..1954917 (-) | 342 | WP_279525801.1 | head-tail connector protein | - |
| JN168_RS09135 | - | 1954936..1956291 (-) | 1356 | WP_279525802.1 | phage major capsid protein | - |
| JN168_RS09140 | - | 1956330..1956887 (-) | 558 | WP_232165333.1 | HK97 family phage prohead protease | - |
| JN168_RS09145 | - | 1956877..1958109 (-) | 1233 | WP_279525803.1 | phage portal protein | - |
| JN168_RS09150 | - | 1958112..1958297 (-) | 186 | WP_279525804.1 | hypothetical protein | - |
| JN168_RS09155 | - | 1958312..1960064 (-) | 1753 | Protein_1772 | terminase TerL endonuclease subunit | - |
| JN168_RS09160 | - | 1960057..1960542 (-) | 486 | WP_107579395.1 | phage terminase small subunit P27 family | - |
| JN168_RS09165 | - | 1960675..1961025 (-) | 351 | WP_107579394.1 | HNH endonuclease | - |
| JN168_RS09170 | - | 1961565..1962011 (-) | 447 | WP_279525805.1 | transcriptional regulator | - |
| JN168_RS09175 | - | 1962176..1962370 (-) | 195 | WP_279525806.1 | transcriptional activator RinB | - |
| JN168_RS09180 | - | 1962367..1962531 (-) | 165 | WP_279525807.1 | hypothetical protein | - |
| JN168_RS09185 | - | 1962531..1962983 (-) | 453 | WP_279525808.1 | hypothetical protein | - |
| JN168_RS09190 | - | 1962986..1963138 (-) | 153 | WP_279525809.1 | DUF1381 domain-containing protein | - |
| JN168_RS09195 | - | 1963143..1963319 (-) | 177 | WP_279525810.1 | hypothetical protein | - |
| JN168_RS09200 | - | 1963369..1963878 (-) | 510 | WP_279526275.1 | dUTP pyrophosphatase | - |
| JN168_RS09205 | - | 1963913..1964143 (-) | 231 | WP_279525811.1 | hypothetical protein | - |
| JN168_RS09210 | - | 1964157..1964357 (-) | 201 | WP_042738316.1 | hypothetical protein | - |
| JN168_RS09215 | - | 1964358..1964705 (-) | 348 | WP_042738315.1 | hypothetical protein | - |
| JN168_RS09220 | - | 1964719..1964904 (-) | 186 | WP_126542119.1 | hypothetical protein | - |
| JN168_RS09225 | - | 1964908..1965321 (-) | 414 | WP_042738313.1 | hypothetical protein | - |
| JN168_RS09230 | - | 1965323..1965733 (-) | 411 | WP_279525813.1 | hypothetical protein | - |
| JN168_RS09235 | - | 1965936..1966520 (-) | 585 | WP_279525814.1 | DUF3310 domain-containing protein | - |
| JN168_RS09240 | - | 1966521..1966880 (-) | 360 | WP_279525815.1 | SA1788 family PVL leukocidin-associated protein | - |
| JN168_RS09245 | - | 1966880..1967077 (-) | 198 | WP_279525816.1 | hypothetical protein | - |
| JN168_RS09250 | - | 1967077..1967490 (-) | 414 | WP_279525817.1 | YopX family protein | - |
| JN168_RS09255 | - | 1967497..1967901 (-) | 405 | WP_279525818.1 | DUF1064 domain-containing protein | - |
| JN168_RS09260 | - | 1967912..1968085 (-) | 174 | WP_279525819.1 | hypothetical protein | - |
| JN168_RS09265 | - | 1968049..1968297 (-) | 249 | WP_279525820.1 | hypothetical protein | - |
| JN168_RS09270 | - | 1968294..1969544 (-) | 1251 | WP_279525821.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| JN168_RS09275 | - | 1969537..1969893 (-) | 357 | WP_107641481.1 | hypothetical protein | - |
| JN168_RS09280 | - | 1969898..1970623 (-) | 726 | WP_279525822.1 | conserved phage C-terminal domain-containing protein | - |
| JN168_RS09285 | - | 1970610..1971290 (-) | 681 | WP_279525823.1 | putative HNHc nuclease | - |
| JN168_RS09290 | ssbA | 1971302..1971745 (-) | 444 | WP_279525824.1 | single-stranded DNA-binding protein | Machinery gene |
| JN168_RS09295 | - | 1971748..1972368 (-) | 621 | WP_279525825.1 | DUF1071 domain-containing protein | - |
| JN168_RS09300 | - | 1972361..1972585 (-) | 225 | WP_042738300.1 | DUF2483 family protein | - |
| JN168_RS09305 | - | 1972830..1973153 (-) | 324 | WP_107641475.1 | DUF771 domain-containing protein | - |
| JN168_RS09310 | - | 1973150..1973653 (-) | 504 | WP_279525826.1 | hypothetical protein | - |
| JN168_RS09315 | - | 1973766..1973990 (-) | 225 | WP_279526276.1 | DUF739 family protein | - |
| JN168_RS09320 | - | 1974153..1974557 (+) | 405 | WP_279525827.1 | helix-turn-helix domain-containing protein | - |
| JN168_RS09325 | - | 1974559..1974996 (+) | 438 | WP_279525828.1 | ImmA/IrrE family metallo-endopeptidase | - |
| JN168_RS09330 | - | 1975037..1975348 (+) | 312 | WP_279525829.1 | hypothetical protein | - |
| JN168_RS09335 | - | 1975428..1975988 (+) | 561 | WP_279525830.1 | hypothetical protein | - |
| JN168_RS09340 | - | 1976048..1977109 (+) | 1062 | WP_279525831.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 147 a.a. Molecular weight: 16285.92 Da Isoelectric Point: 5.2281
>NTDB_id=532250 JN168_RS09290 WP_279525824.1 1971302..1971745(-) (ssbA) [Staphylococcus gallinarum strain STP534]
MINRVVLVGRLTKEPEFRTTPSGISIANFTLAINRTFTNAQGEREADFINVVVFKKQAEDVNNYLSKGNLAGVDGRIQSR
SYENNEGKRVFVTEVVADSVQFLEPKNNGQANNTSKVQQTGANNQRSSNDNPFSNNDINLDSDSLPF
MINRVVLVGRLTKEPEFRTTPSGISIANFTLAINRTFTNAQGEREADFINVVVFKKQAEDVNNYLSKGNLAGVDGRIQSR
SYENNEGKRVFVTEVVADSVQFLEPKNNGQANNTSKVQQTGANNQRSSNDNPFSNNDINLDSDSLPF
Nucleotide
Download Length: 444 bp
>NTDB_id=532250 JN168_RS09290 WP_279525824.1 1971302..1971745(-) (ssbA) [Staphylococcus gallinarum strain STP534]
ATGATAAACAGAGTTGTATTAGTAGGACGATTAACGAAAGAGCCAGAATTTAGAACGACGCCATCTGGCATAAGTATTGC
TAACTTCACCCTAGCTATTAATAGAACATTTACAAATGCTCAAGGAGAACGTGAAGCTGATTTTATAAACGTAGTCGTAT
TTAAAAAGCAAGCAGAGGACGTAAATAATTACTTATCAAAAGGTAATTTGGCTGGCGTTGATGGTCGTATACAGTCAAGA
AGTTATGAAAATAATGAAGGTAAACGAGTGTTCGTTACTGAAGTTGTCGCAGACAGTGTTCAATTCTTAGAACCAAAAAA
CAACGGACAGGCAAACAACACCTCTAAAGTACAACAGACAGGCGCAAATAACCAACGTTCAAGCAATGATAACCCATTCA
GTAATAACGACATAAACTTAGACAGTGATTCGTTACCGTTCTAA
ATGATAAACAGAGTTGTATTAGTAGGACGATTAACGAAAGAGCCAGAATTTAGAACGACGCCATCTGGCATAAGTATTGC
TAACTTCACCCTAGCTATTAATAGAACATTTACAAATGCTCAAGGAGAACGTGAAGCTGATTTTATAAACGTAGTCGTAT
TTAAAAAGCAAGCAGAGGACGTAAATAATTACTTATCAAAAGGTAATTTGGCTGGCGTTGATGGTCGTATACAGTCAAGA
AGTTATGAAAATAATGAAGGTAAACGAGTGTTCGTTACTGAAGTTGTCGCAGACAGTGTTCAATTCTTAGAACCAAAAAA
CAACGGACAGGCAAACAACACCTCTAAAGTACAACAGACAGGCGCAAATAACCAACGTTCAAGCAATGATAACCCATTCA
GTAATAACGACATAAACTTAGACAGTGATTCGTTACCGTTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.651 |
100 |
0.639 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
45.665 |
100 |
0.537 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
54.955 |
75.51 |
0.415 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
40.816 |
100 |
0.408 |
| ssbA | Streptococcus mutans UA159 |
38.255 |
100 |
0.388 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
36.242 |
100 |
0.367 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
36.242 |
100 |
0.367 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
35.57 |
100 |
0.361 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
35.57 |
100 |
0.361 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
35.57 |
100 |
0.361 |
| ssbB/cilA | Streptococcus mitis SK321 |
35.57 |
100 |
0.361 |