Detailed information
Overview
| Name | comYC | Type | Machinery gene |
| Locus tag | I6J12_RS00030 | Genome accession | NZ_CP068060 |
| Coordinates | 3315..3584 (+) | Length | 89 a.a. |
| NCBI ID | WP_003035361.1 | Uniprot ID | I0SGR5 |
| Organism | Streptococcus anginosus strain FDAARGOS_1155 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 57..6003 | 3315..3584 | within | 0 |
Gene organization within MGE regions
Location: 57..6003
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| I6J12_RS00010 (I6J12_00010) | - | 845..1387 (+) | 543 | WP_003038192.1 | DUF1366 domain-containing protein | - |
| I6J12_RS00015 (I6J12_00015) | - | 1405..1806 (+) | 402 | WP_003038210.1 | hypothetical protein | - |
| I6J12_RS00020 (I6J12_00020) | - | 1808..2140 (+) | 333 | WP_003038184.1 | phage holin | - |
| I6J12_RS00025 (I6J12_00025) | - | 2143..2892 (+) | 750 | WP_003038204.1 | PlySs2 family phage lysin | - |
| I6J12_RS00030 (I6J12_00030) | comYC | 3315..3584 (+) | 270 | WP_003035361.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| I6J12_RS00035 (I6J12_00035) | comYD | 3544..3972 (+) | 429 | WP_020999411.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| I6J12_RS00040 (I6J12_00040) | comGE/cglE | 3944..4237 (+) | 294 | WP_003035318.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| I6J12_RS00045 (I6J12_00045) | comGF/cglF | 4221..4658 (+) | 438 | WP_003035329.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| I6J12_RS00050 (I6J12_00050) | comGG | 4639..4965 (+) | 327 | WP_020999447.1 | competence type IV pilus minor pilin ComGG | - |
| I6J12_RS00055 (I6J12_00055) | comYH | 5050..6003 (+) | 954 | WP_003035359.1 | class I SAM-dependent methyltransferase | Machinery gene |
Sequence
Protein
Download Length: 89 a.a. Molecular weight: 9806.44 Da Isoelectric Point: 8.4759
>NTDB_id=526764 I6J12_RS00030 WP_003035361.1 3315..3584(+) (comYC) [Streptococcus anginosus strain FDAARGOS_1155]
MLVVLLIISVLMLLFVPNLTKQKEAVTEKGNAAVVKVVESQAELFEVNHTNEKATLSKLVSEGTITDKQAVSYKAYYAKH
TKEARTVAD
MLVVLLIISVLMLLFVPNLTKQKEAVTEKGNAAVVKVVESQAELFEVNHTNEKATLSKLVSEGTITDKQAVSYKAYYAKH
TKEARTVAD
Nucleotide
Download Length: 270 bp
>NTDB_id=526764 I6J12_RS00030 WP_003035361.1 3315..3584(+) (comYC) [Streptococcus anginosus strain FDAARGOS_1155]
ATGTTAGTGGTGCTTCTAATCATCAGTGTTTTGATGCTTTTGTTTGTTCCGAATTTGACCAAACAAAAAGAAGCTGTAAC
GGAAAAAGGAAATGCAGCTGTTGTGAAGGTTGTCGAAAGTCAGGCAGAGCTTTTTGAAGTGAATCATACTAATGAAAAAG
CGACGCTTTCAAAATTAGTCAGTGAAGGAACTATTACAGACAAGCAAGCAGTATCATACAAGGCTTATTATGCAAAACAT
ACAAAAGAAGCTCGCACAGTTGCAGATTAA
ATGTTAGTGGTGCTTCTAATCATCAGTGTTTTGATGCTTTTGTTTGTTCCGAATTTGACCAAACAAAAAGAAGCTGTAAC
GGAAAAAGGAAATGCAGCTGTTGTGAAGGTTGTCGAAAGTCAGGCAGAGCTTTTTGAAGTGAATCATACTAATGAAAAAG
CGACGCTTTCAAAATTAGTCAGTGAAGGAACTATTACAGACAAGCAAGCAGTATCATACAAGGCTTATTATGCAAAACAT
ACAAAAGAAGCTCGCACAGTTGCAGATTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
73.034 |
100 |
0.73 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
65.169 |
100 |
0.652 |
| comGC/cglC | Streptococcus pneumoniae D39 |
65.169 |
100 |
0.652 |
| comGC/cglC | Streptococcus pneumoniae R6 |
65.169 |
100 |
0.652 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
65.169 |
100 |
0.652 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
64 |
84.27 |
0.539 |
| comYC | Streptococcus mutans UA140 |
64.384 |
82.022 |
0.528 |
| comYC | Streptococcus mutans UA159 |
64.384 |
82.022 |
0.528 |
| comGC/cglC | Streptococcus mitis SK321 |
62.667 |
84.27 |
0.528 |
| comYC | Streptococcus suis isolate S10 |
63.014 |
82.022 |
0.517 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
53.947 |
85.393 |
0.461 |