Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   JF380_RS04335 Genome accession   NZ_CP066492
Coordinates   879630..880052 (+) Length   140 a.a.
NCBI ID   WP_198914225.1    Uniprot ID   -
Organism   Staphylococcus aureus strain nan_175_F371_ch     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 869508..916118 879630..880052 within 0


Gene organization within MGE regions


Location: 869508..916118
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JF380_RS04240 (JF380_04240) sufU 869508..869972 (+) 465 WP_001010508.1 Fe-S cluster assembly sulfur transfer protein SufU -
  JF380_RS04245 (JF380_04245) sufB 870123..871520 (+) 1398 WP_001074405.1 Fe-S cluster assembly protein SufB -
  JF380_RS04250 (JF380_04250) - 871588..872637 (-) 1050 WP_198914216.1 tyrosine-type recombinase/integrase -
  JF380_RS04255 (JF380_04255) - 872704..872946 (-) 243 WP_016187262.1 hypothetical protein -
  JF380_RS04260 (JF380_04260) - 872957..873940 (-) 984 WP_021285964.1 glycosyltransferase family 2 protein -
  JF380_RS04265 (JF380_04265) - 873958..874416 (-) 459 WP_198914217.1 ImmA/IrrE family metallo-endopeptidase -
  JF380_RS04270 (JF380_04270) - 874438..874764 (-) 327 WP_000455972.1 helix-turn-helix domain-containing protein -
  JF380_RS04275 (JF380_04275) - 874927..875136 (+) 210 WP_001114715.1 helix-turn-helix transcriptional regulator -
  JF380_RS04280 (JF380_04280) - 875175..875951 (+) 777 WP_198914218.1 Rha family transcriptional regulator -
  JF380_RS04285 (JF380_04285) - 875980..876132 (+) 153 WP_198914219.1 hypothetical protein -
  JF380_RS04290 (JF380_04290) - 876101..876283 (-) 183 WP_198914220.1 hypothetical protein -
  JF380_RS04295 (JF380_04295) - 876392..876844 (-) 453 WP_198914221.1 hypothetical protein -
  JF380_RS04300 (JF380_04300) - 877055..877285 (-) 231 WP_000395455.1 hypothetical protein -
  JF380_RS04305 (JF380_04305) - 877355..877585 (+) 231 WP_096659904.1 hypothetical protein -
  JF380_RS04310 (JF380_04310) - 877569..877730 (+) 162 WP_015977963.1 DUF1270 domain-containing protein -
  JF380_RS04315 (JF380_04315) - 877866..878168 (+) 303 WP_198914222.1 DUF2482 family protein -
  JF380_RS04320 (JF380_04320) - 878173..878433 (+) 261 WP_198914223.1 DUF1108 family protein -
  JF380_RS04325 (JF380_04325) - 878446..878982 (+) 537 WP_198914224.1 host-nuclease inhibitor Gam family protein -
  JF380_RS04330 (JF380_04330) - 878983..879630 (+) 648 WP_196582311.1 ERF family protein -
  JF380_RS04335 (JF380_04335) ssbA 879630..880052 (+) 423 WP_198914225.1 single-stranded DNA-binding protein Machinery gene
  JF380_RS04340 (JF380_04340) - 880066..880734 (+) 669 WP_198914226.1 putative HNHc nuclease -
  JF380_RS04345 (JF380_04345) - 880734..881516 (+) 783 WP_000240898.1 AP2 domain-containing protein -
  JF380_RS04350 (JF380_04350) - 881488..882291 (+) 804 WP_029550175.1 phage replisome organizer N-terminal domain-containing protein -
  JF380_RS04355 (JF380_04355) - 882301..883074 (+) 774 WP_031925044.1 ATP-binding protein -
  JF380_RS04360 (JF380_04360) - 883068..883226 (+) 159 WP_000256594.1 hypothetical protein -
  JF380_RS04365 (JF380_04365) - 883239..883460 (+) 222 WP_029550479.1 DUF3269 family protein -
  JF380_RS04370 (JF380_04370) - 883470..883874 (+) 405 WP_000049777.1 DUF1064 domain-containing protein -
  JF380_RS04375 (JF380_04375) - 883879..884064 (+) 186 WP_029625657.1 DUF3113 family protein -
  JF380_RS04380 (JF380_04380) - 884065..884436 (+) 372 WP_198914227.1 SA1788 family PVL leukocidin-associated protein -
  JF380_RS04385 (JF380_04385) - 884437..884685 (+) 249 WP_033842683.1 SAV1978 family virulence-associated passenger protein -
  JF380_RS04390 (JF380_04390) - 884700..884948 (+) 249 WP_198914270.1 DUF1024 family protein -
  JF380_RS04395 (JF380_04395) - 884941..885450 (+) 510 WP_198914228.1 dUTP diphosphatase -
  JF380_RS04400 (JF380_04400) - 885487..885687 (+) 201 WP_198914229.1 hypothetical protein -
  JF380_RS14460 - 885687..885776 (+) 90 Protein_865 DUF1381 domain-containing protein -
  JF380_RS04410 (JF380_04410) - 885910..886296 (+) 387 WP_198914231.1 hypothetical protein -
  JF380_RS04415 (JF380_04415) rinB 886293..886430 (+) 138 WP_198914232.1 transcriptional activator RinB -
  JF380_RS04420 (JF380_04420) - 886431..886832 (+) 402 WP_000286968.1 hypothetical protein -
  JF380_RS04425 (JF380_04425) - 887187..887681 (+) 495 WP_053040368.1 terminase small subunit -
  JF380_RS04430 (JF380_04430) - 887674..888882 (+) 1209 WP_001606760.1 PBSX family phage terminase large subunit -
  JF380_RS04435 (JF380_04435) - 888836..890314 (+) 1479 WP_198914233.1 phage portal protein -
  JF380_RS04440 (JF380_04440) - 890253..891233 (+) 981 WP_136430717.1 phage head morphogenesis protein -
  JF380_RS04445 (JF380_04445) - 891331..891927 (+) 597 WP_000366931.1 phage scaffolding protein -
  JF380_RS04450 (JF380_04450) - 891948..892772 (+) 825 WP_001135550.1 N4-gp56 family major capsid protein -
  JF380_RS04455 (JF380_04455) - 892789..893115 (+) 327 WP_198914234.1 Rho termination factor N-terminal domain-containing protein -
  JF380_RS04460 (JF380_04460) - 893115..893429 (+) 315 WP_000991902.1 phage head-tail connector protein -
  JF380_RS04465 (JF380_04465) - 893422..893757 (+) 336 WP_000482985.1 phage head closure protein -
  JF380_RS04470 (JF380_04470) - 893744..894157 (+) 414 WP_001151331.1 HK97-gp10 family putative phage morphogenesis protein -
  JF380_RS04475 (JF380_04475) - 894170..894607 (+) 438 WP_000270196.1 DUF3168 domain-containing protein -
  JF380_RS04480 (JF380_04480) - 894594..895154 (+) 561 WP_000046067.1 hypothetical protein -
  JF380_RS04485 (JF380_04485) - 895216..895710 (+) 495 WP_000141084.1 tail assembly chaperone -
  JF380_RS04490 (JF380_04490) - 895731..896072 (+) 342 WP_000204079.1 hypothetical protein -
  JF380_RS04495 (JF380_04495) - 896075..899044 (+) 2970 WP_198914235.1 phage tail protein -
  JF380_RS04500 (JF380_04500) - 899059..899994 (+) 936 WP_198914236.1 phage tail domain-containing protein -
  JF380_RS04505 (JF380_04505) - 900005..901891 (+) 1887 WP_198914237.1 SGNH/GDSL hydrolase family protein -
  JF380_RS04510 (JF380_04510) - 901904..903802 (+) 1899 WP_198914238.1 hypothetical protein -
  JF380_RS04515 (JF380_04515) - 903802..905625 (+) 1824 WP_198914239.1 BppU family phage baseplate upper protein -
  JF380_RS04520 (JF380_04520) - 905625..906002 (+) 378 WP_198914240.1 DUF2977 domain-containing protein -
  JF380_RS04525 (JF380_04525) - 906006..906179 (+) 174 WP_078098837.1 XkdX family protein -
  JF380_RS04530 (JF380_04530) - 906218..906652 (+) 435 WP_115118279.1 hypothetical protein -
  JF380_RS04535 (JF380_04535) - 906636..907031 (+) 396 WP_044290563.1 hypothetical protein -
  JF380_RS04540 (JF380_04540) - 907084..908958 (+) 1875 WP_198914241.1 glucosaminidase domain-containing protein -
  JF380_RS14275 - 909069..909176 (+) 108 WP_233144388.1 putative holin-like toxin -
  JF380_RS14465 - 909220..909300 (-) 81 Protein_894 hypothetical protein -
  JF380_RS04550 (JF380_04550) - 909370..909645 (+) 276 WP_198914242.1 phage holin -
  JF380_RS04555 (JF380_04555) - 909632..911044 (+) 1413 WP_198914243.1 N-acetylmuramoyl-L-alanine amidase -
  JF380_RS04560 (JF380_04560) - 911135..911635 (-) 501 WP_198914244.1 SA1002 family membrane protein -
  JF380_RS04565 (JF380_04565) - 912109..912261 (+) 153 WP_001788502.1 hypothetical protein -
  JF380_RS04570 (JF380_04570) - 912332..912442 (+) 111 WP_000139423.1 hypothetical protein -
  JF380_RS04575 (JF380_04575) - 912444..912629 (+) 186 WP_001286805.1 hypothetical protein -
  JF380_RS04580 (JF380_04580) - 913201..913758 (+) 558 WP_198914245.1 PBECR4 domain-containing protein -
  JF380_RS04585 (JF380_04585) - 914256..914393 (+) 138 WP_001790198.1 chorismate mutase -
  JF380_RS04590 (JF380_04590) - 914399..914713 (-) 315 WP_000274029.1 hypothetical protein -
  JF380_RS04595 (JF380_04595) - 915078..916118 (+) 1041 WP_000582332.1 hemolysin family protein -

Sequence

Protein


Download         Length: 140 a.a.        Molecular weight: 15567.20 Da        Isoelectric Point: 6.3581

>NTDB_id=520455 JF380_RS04335 WP_198914225.1 879630..880052(+) (ssbA) [Staphylococcus aureus strain nan_175_F371_ch]
MLNRTVLVGRLTKDPELRSTPNGVNVGTFTLAVNRTFTNAQGEREADFFNVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYDNKVGQRVFVTEVVADSVQFLEPKNNNQQNNQQPNGQTQTGNNPFDNTTAITDDELPF

Nucleotide


Download         Length: 423 bp        

>NTDB_id=520455 JF380_RS04335 WP_198914225.1 879630..880052(+) (ssbA) [Staphylococcus aureus strain nan_175_F371_ch]
ATGTTAAACAGAACAGTATTAGTAGGACGATTAACAAAAGACCCAGAATTAAGAAGCACGCCAAACGGCGTAAATGTAGG
GACATTCACATTAGCAGTAAACAGAACATTTACGAATGCTCAAGGCGAGCGTGAAGCAGACTTTTTTAACGTAGTAGTGT
TCAAAAAACAAGCTGAAAACGTTAAAAACTACCTTTCTAAAGGGTCACTGGCAGGTGTTGACGGACGATTACAAACACGT
AGCTACGATAACAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAGAATAACCAACAACCCAACGGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTGCCATTA
CTGATGATGAATTACCGTTCTGA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.