Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | I6H64_RS05650 | Genome accession | NZ_CP066046 |
| Coordinates | 1140047..1140472 (-) | Length | 141 a.a. |
| NCBI ID | WP_008842074.1 | Uniprot ID | - |
| Organism | Pediococcus acidilactici strain FDAARGOS_1007 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1094045..1148302 | 1140047..1140472 | within | 0 |
Gene organization within MGE regions
Location: 1094045..1148302
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| I6H64_RS10120 | - | 1094045..1094254 (-) | 210 | WP_205600602.1 | hypothetical protein | - |
| I6H64_RS10125 | - | 1094398..1101396 (+) | 6999 | WP_232623491.1 | hypothetical protein | - |
| I6H64_RS10265 | - | 1102365..1102451 (-) | 87 | Protein_1046 | KxYKxGKxW signal peptide domain-containing protein | - |
| I6H64_RS05400 (I6H64_05400) | - | 1102611..1102946 (-) | 336 | WP_005919288.1 | hypothetical protein | - |
| I6H64_RS05405 (I6H64_05405) | - | 1103724..1104641 (-) | 918 | WP_008842374.1 | dihydrodipicolinate synthase family protein | - |
| I6H64_RS05410 (I6H64_05410) | - | 1104656..1106164 (-) | 1509 | WP_005919281.1 | sodium:solute symporter | - |
| I6H64_RS05415 (I6H64_05415) | - | 1106417..1107148 (-) | 732 | WP_008842377.1 | sugar phosphate isomerase/epimerase family protein | - |
| I6H64_RS05420 (I6H64_05420) | - | 1107129..1107977 (-) | 849 | WP_056985220.1 | ROK family protein | - |
| I6H64_RS05425 (I6H64_05425) | - | 1108743..1109330 (-) | 588 | WP_008842030.1 | GNAT family N-acetyltransferase | - |
| I6H64_RS05430 (I6H64_05430) | - | 1109330..1109494 (-) | 165 | WP_158002714.1 | hypothetical protein | - |
| I6H64_RS05435 (I6H64_05435) | - | 1109787..1110905 (-) | 1119 | WP_008842031.1 | peptidoglycan recognition family protein | - |
| I6H64_RS05440 (I6H64_05440) | - | 1110889..1111131 (-) | 243 | WP_008842032.1 | phage holin | - |
| I6H64_RS05445 (I6H64_05445) | - | 1111131..1111421 (-) | 291 | WP_036685647.1 | hypothetical protein | - |
| I6H64_RS05450 (I6H64_05450) | - | 1111479..1112969 (-) | 1491 | WP_008842034.1 | hypothetical protein | - |
| I6H64_RS05455 (I6H64_05455) | - | 1112981..1113802 (-) | 822 | WP_008842035.1 | collagen-like protein | - |
| I6H64_RS05460 (I6H64_05460) | - | 1113814..1114851 (-) | 1038 | WP_008842036.1 | BppU family phage baseplate upper protein | - |
| I6H64_RS05465 (I6H64_05465) | - | 1114841..1115398 (-) | 558 | WP_008842037.1 | hypothetical protein | - |
| I6H64_RS05470 (I6H64_05470) | - | 1115398..1118313 (-) | 2916 | WP_056985218.1 | phage tail protein | - |
| I6H64_RS05475 (I6H64_05475) | - | 1118313..1119074 (-) | 762 | WP_008842040.1 | hypothetical protein | - |
| I6H64_RS05480 (I6H64_05480) | - | 1119074..1122094 (-) | 3021 | WP_008842041.1 | phage tail tape measure protein | - |
| I6H64_RS05485 (I6H64_05485) | - | 1122078..1122395 (-) | 318 | WP_008842042.1 | hypothetical protein | - |
| I6H64_RS05490 (I6H64_05490) | - | 1122494..1122829 (-) | 336 | WP_008842043.1 | tail assembly chaperone | - |
| I6H64_RS05495 (I6H64_05495) | - | 1122895..1123173 (-) | 279 | WP_008842044.1 | hypothetical protein | - |
| I6H64_RS05500 (I6H64_05500) | - | 1123251..1123853 (-) | 603 | WP_008842045.1 | phage major tail protein, TP901-1 family | - |
| I6H64_RS05505 (I6H64_05505) | - | 1123871..1124272 (-) | 402 | WP_008842046.1 | hypothetical protein | - |
| I6H64_RS05510 (I6H64_05510) | - | 1124273..1124614 (-) | 342 | WP_008842047.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| I6H64_RS05515 (I6H64_05515) | - | 1124607..1124912 (-) | 306 | WP_036685659.1 | hypothetical protein | - |
| I6H64_RS05520 (I6H64_05520) | - | 1124917..1125291 (-) | 375 | WP_008842048.1 | phage head-tail connector protein | - |
| I6H64_RS05525 (I6H64_05525) | - | 1125303..1125548 (-) | 246 | WP_008842049.1 | Ig-like domain-containing protein | - |
| I6H64_RS05530 (I6H64_05530) | - | 1125587..1126405 (-) | 819 | WP_056985216.1 | N4-gp56 family major capsid protein | - |
| I6H64_RS05535 (I6H64_05535) | - | 1126405..1127121 (-) | 717 | WP_008842052.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| I6H64_RS05540 (I6H64_05540) | - | 1127229..1127438 (-) | 210 | WP_036685661.1 | hypothetical protein | - |
| I6H64_RS05545 (I6H64_05545) | - | 1127450..1128421 (-) | 972 | WP_036685662.1 | minor capsid protein | - |
| I6H64_RS05550 (I6H64_05550) | - | 1128390..1129685 (-) | 1296 | WP_144235491.1 | phage portal protein | - |
| I6H64_RS05555 (I6H64_05555) | - | 1129806..1131074 (-) | 1269 | WP_036685666.1 | PBSX family phage terminase large subunit | - |
| I6H64_RS05560 (I6H64_05560) | - | 1131064..1131588 (-) | 525 | WP_008842056.1 | terminase small subunit | - |
| I6H64_RS05565 (I6H64_05565) | - | 1132095..1132538 (-) | 444 | WP_008842057.1 | hypothetical protein | - |
| I6H64_RS05570 (I6H64_05570) | - | 1132644..1132880 (-) | 237 | WP_036685668.1 | hypothetical protein | - |
| I6H64_RS05575 (I6H64_05575) | - | 1132855..1133073 (-) | 219 | WP_036685670.1 | hypothetical protein | - |
| I6H64_RS05580 (I6H64_05580) | - | 1133098..1133274 (-) | 177 | WP_008842059.1 | hypothetical protein | - |
| I6H64_RS05585 (I6H64_05585) | - | 1133279..1133524 (-) | 246 | WP_008842060.1 | hypothetical protein | - |
| I6H64_RS05590 (I6H64_05590) | - | 1133524..1133832 (-) | 309 | WP_036685671.1 | hypothetical protein | - |
| I6H64_RS05595 (I6H64_05595) | - | 1133852..1134280 (-) | 429 | WP_008842062.1 | DUF1642 domain-containing protein | - |
| I6H64_RS05600 (I6H64_05600) | - | 1134280..1134870 (-) | 591 | WP_008842063.1 | DUF1642 domain-containing protein | - |
| I6H64_RS05605 (I6H64_05605) | - | 1135040..1135411 (-) | 372 | WP_036685673.1 | hypothetical protein | - |
| I6H64_RS05610 (I6H64_05610) | - | 1135398..1135547 (-) | 150 | WP_008842066.1 | hypothetical protein | - |
| I6H64_RS05615 (I6H64_05615) | - | 1135578..1136198 (-) | 621 | WP_008842067.1 | hypothetical protein | - |
| I6H64_RS05620 (I6H64_05620) | - | 1136198..1136425 (-) | 228 | WP_008842068.1 | hypothetical protein | - |
| I6H64_RS05625 (I6H64_05625) | - | 1136425..1136856 (-) | 432 | WP_036685676.1 | RusA family crossover junction endodeoxyribonuclease | - |
| I6H64_RS05630 (I6H64_05630) | - | 1136853..1137260 (-) | 408 | WP_232623524.1 | hypothetical protein | - |
| I6H64_RS05635 (I6H64_05635) | - | 1137269..1138501 (-) | 1233 | WP_008842071.1 | replicative DNA helicase | - |
| I6H64_RS05640 (I6H64_05640) | - | 1138491..1139357 (-) | 867 | WP_008842072.1 | conserved phage C-terminal domain-containing protein | - |
| I6H64_RS05645 (I6H64_05645) | - | 1139335..1140036 (-) | 702 | WP_008842073.1 | putative HNHc nuclease | - |
| I6H64_RS05650 (I6H64_05650) | ssb | 1140047..1140472 (-) | 426 | WP_008842074.1 | single-stranded DNA-binding protein | Machinery gene |
| I6H64_RS05655 (I6H64_05655) | - | 1140465..1141163 (-) | 699 | WP_008842075.1 | ERF family protein | - |
| I6H64_RS05660 (I6H64_05660) | - | 1141164..1141619 (-) | 456 | WP_036685680.1 | hypothetical protein | - |
| I6H64_RS05665 (I6H64_05665) | - | 1141782..1142003 (-) | 222 | WP_036685683.1 | hypothetical protein | - |
| I6H64_RS05670 (I6H64_05670) | - | 1142101..1142307 (-) | 207 | WP_008842077.1 | hypothetical protein | - |
| I6H64_RS05675 (I6H64_05675) | - | 1142376..1143101 (-) | 726 | WP_008842078.1 | Rha family transcriptional regulator | - |
| I6H64_RS05680 (I6H64_05680) | - | 1143214..1143402 (-) | 189 | WP_008842079.1 | helix-turn-helix domain-containing protein | - |
| I6H64_RS05685 (I6H64_05685) | - | 1143692..1144024 (+) | 333 | WP_008842080.1 | helix-turn-helix domain-containing protein | - |
| I6H64_RS05690 (I6H64_05690) | - | 1144039..1144323 (+) | 285 | WP_008842081.1 | hypothetical protein | - |
| I6H64_RS05695 (I6H64_05695) | - | 1144383..1145045 (+) | 663 | WP_008842082.1 | hypothetical protein | - |
| I6H64_RS10135 | - | 1145112..1145999 (+) | 888 | WP_066027433.1 | DUF5067 domain-containing protein | - |
| I6H64_RS05705 (I6H64_05705) | - | 1146138..1147217 (+) | 1080 | WP_008842084.1 | tyrosine-type recombinase/integrase | - |
| I6H64_RS05715 (I6H64_05715) | - | 1147613..1148302 (+) | 690 | WP_008842223.1 | N-acetylmannosamine-6-phosphate 2-epimerase | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15598.34 Da Isoelectric Point: 7.9972
>NTDB_id=516783 I6H64_RS05650 WP_008842074.1 1140047..1140472(-) (ssb) [Pediococcus acidilactici strain FDAARGOS_1007]
MINRTILIGRLTKDVELRHTAKGDAVASFTVAVNRQFTNSQGEREADFINCVMWRKAAENFAKYTQKGSLVGIEGRIQTR
SYENQQGQRVYVTEVVADNFSLLDSKPKGNQQNNARQASTPGDPFANGGQSIDIGDDSLPF
MINRTILIGRLTKDVELRHTAKGDAVASFTVAVNRQFTNSQGEREADFINCVMWRKAAENFAKYTQKGSLVGIEGRIQTR
SYENQQGQRVYVTEVVADNFSLLDSKPKGNQQNNARQASTPGDPFANGGQSIDIGDDSLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=516783 I6H64_RS05650 WP_008842074.1 1140047..1140472(-) (ssb) [Pediococcus acidilactici strain FDAARGOS_1007]
ATGATTAATCGAACAATACTAATAGGACGTTTAACTAAAGATGTTGAGCTTCGCCACACAGCTAAAGGTGATGCGGTAGC
TAGTTTTACCGTGGCAGTTAACCGACAGTTTACCAACTCACAGGGTGAACGTGAAGCAGATTTCATTAACTGCGTAATGT
GGCGTAAGGCAGCAGAAAACTTCGCTAAGTATACACAAAAAGGTTCGTTGGTAGGTATTGAAGGGCGGATTCAGACCCGT
TCATACGAAAACCAACAAGGACAACGAGTTTATGTAACTGAGGTTGTAGCGGATAACTTCTCGTTGTTAGATTCGAAGCC
AAAAGGCAACCAGCAAAATAACGCACGGCAAGCATCAACGCCAGGAGATCCATTCGCTAATGGCGGGCAGTCAATTGATA
TTGGTGACGATAGTTTGCCTTTCTAA
ATGATTAATCGAACAATACTAATAGGACGTTTAACTAAAGATGTTGAGCTTCGCCACACAGCTAAAGGTGATGCGGTAGC
TAGTTTTACCGTGGCAGTTAACCGACAGTTTACCAACTCACAGGGTGAACGTGAAGCAGATTTCATTAACTGCGTAATGT
GGCGTAAGGCAGCAGAAAACTTCGCTAAGTATACACAAAAAGGTTCGTTGGTAGGTATTGAAGGGCGGATTCAGACCCGT
TCATACGAAAACCAACAAGGACAACGAGTTTATGTAACTGAGGTTGTAGCGGATAACTTCTCGTTGTTAGATTCGAAGCC
AAAAGGCAACCAGCAAAATAACGCACGGCAAGCATCAACGCCAGGAGATCCATTCGCTAATGGCGGGCAGTCAATTGATA
TTGGTGACGATAGTTTGCCTTTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
57.647 |
100 |
0.695 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
52.907 |
100 |
0.645 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
62.037 |
76.596 |
0.475 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
42.254 |
100 |
0.426 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
42.254 |
100 |
0.426 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
41.549 |
100 |
0.418 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
41.549 |
100 |
0.418 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
41.549 |
100 |
0.418 |
| ssbB/cilA | Streptococcus mitis SK321 |
41.549 |
100 |
0.418 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
41.549 |
100 |
0.418 |
| ssbA | Streptococcus mutans UA159 |
38.028 |
100 |
0.383 |