Detailed information
Overview
| Name | comC/comC2 | Type | Regulator |
| Locus tag | I6I32_RS05445 | Genome accession | NZ_CP066041 |
| Coordinates | 1107956..1108081 (+) | Length | 41 a.a. |
| NCBI ID | WP_000799678.1 | Uniprot ID | - |
| Organism | Streptococcus oralis strain FDAARGOS_1075 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1102956..1113081
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| I6I32_RS05420 (I6I32_05420) | dnaA | 1103420..1104781 (-) | 1362 | WP_000660623.1 | chromosomal replication initiator protein DnaA | - |
| I6I32_RS05425 (I6I32_05425) | spo0J | 1104998..1105756 (-) | 759 | WP_198464230.1 | ParB/RepB/Spo0J family partition protein | Regulator |
| I6I32_RS05430 (I6I32_05430) | htrA | 1105814..1107010 (-) | 1197 | WP_125414985.1 | S1C family serine protease | Regulator |
| I6I32_RS05435 (I6I32_05435) | rlmH | 1107196..1107675 (+) | 480 | WP_198464231.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| I6I32_RS05445 (I6I32_05445) | comC/comC2 | 1107956..1108081 (+) | 126 | WP_000799678.1 | competence-stimulating peptide ComC | Regulator |
| I6I32_RS05450 (I6I32_05450) | comD | 1108102..1109421 (+) | 1320 | WP_198464232.1 | competence system sensor histidine kinase ComD | Regulator |
| I6I32_RS05455 (I6I32_05455) | comE | 1109418..1110170 (+) | 753 | WP_000866079.1 | competence system response regulator transcription factor ComE | Regulator |
| I6I32_RS05470 (I6I32_05470) | - | 1110408..1110950 (-) | 543 | WP_000665080.1 | TetR/AcrR family transcriptional regulator | - |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4960.73 Da Isoelectric Point: 10.3052
>NTDB_id=516660 I6I32_RS05445 WP_000799678.1 1107956..1108081(+) (comC/comC2) [Streptococcus oralis strain FDAARGOS_1075]
MKNTVKLEQFKEVTEAELQEIRGGDWRISETIRNLIFPRRK
MKNTVKLEQFKEVTEAELQEIRGGDWRISETIRNLIFPRRK
Nucleotide
Download Length: 126 bp
>NTDB_id=516660 I6I32_RS05445 WP_000799678.1 1107956..1108081(+) (comC/comC2) [Streptococcus oralis strain FDAARGOS_1075]
ATGAAAAATACAGTAAAGTTGGAACAATTTAAAGAAGTAACAGAGGCAGAATTGCAGGAGATTCGAGGTGGAGATTGGAG
AATTTCAGAAACAATTCGTAATCTTATTTTTCCAAGAAGAAAGTAA
ATGAAAAATACAGTAAAGTTGGAACAATTTAAAGAAGTAACAGAGGCAGAATTGCAGGAGATTCGAGGTGGAGATTGGAG
AATTTCAGAAACAATTCGTAATCTTATTTTTCCAAGAAGAAAGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC2 | Streptococcus pneumoniae A66 |
56.098 |
100 |
0.561 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
56.098 |
100 |
0.561 |
| comC | Streptococcus mitis SK321 |
56.098 |
100 |
0.561 |
| comC/comC1 | Streptococcus pneumoniae R6 |
53.659 |
100 |
0.537 |
| comC/comC1 | Streptococcus pneumoniae G54 |
53.659 |
100 |
0.537 |
| comC/comC1 | Streptococcus pneumoniae D39 |
53.659 |
100 |
0.537 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
53.659 |
100 |
0.537 |
| comC | Streptococcus mitis NCTC 12261 |
47.5 |
97.561 |
0.463 |
| comC/comC2 | Streptococcus gordonii strain NCTC7865 |
43.243 |
90.244 |
0.39 |
| comC/comC1 | Streptococcus gordonii str. Challis substr. CH1 |
39.474 |
92.683 |
0.366 |