Detailed information NTG0515163

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: JC284_RS06010
• Genome accession: NZ_CP065919
• Coordinates: 1282418..1282741 (+)
• Length: 107 a.a.
• NCBI ID: WP_015729165.1
• Uniprot ID: -
• Organism: Staphylococcus pseudintermedius strain SP_11306-4A
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1277418..1287741

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
JC284_RS05980 (JC284_05980)	-	1278094..1278297 (+)	204	WP_014613816.1	YqgQ family protein	-
JC284_RS05985 (JC284_05985)	-	1278294..1279280 (+)	987	WP_014613817.1	ROK family glucokinase	-
JC284_RS05990 (JC284_05990)	-	1279281..1279592 (+)	312	WP_014613818.1	MTH1187 family thiamine-binding protein	-
JC284_RS05995 (JC284_05995)	-	1279605..1280234 (+)	630	WP_037542865.1	MBL fold metallo-hydrolase	-
JC284_RS06000 (JC284_06000)	comGA	1280395..1281369 (+)	975	WP_014613820.1	competence type IV pilus ATPase ComGA	Machinery gene
JC284_RS06005 (JC284_06005)	comGB	1281338..1282405 (+)	1068	WP_037542939.1	competence type IV pilus assembly protein ComGB	-
JC284_RS06010 (JC284_06010)	comGC	1282418..1282741 (+)	324	WP_015729165.1	competence type IV pilus major pilin ComGC	Machinery gene
JC284_RS06015 (JC284_06015)	comGD	1282719..1283159 (+)	441	WP_014613823.1	competence type IV pilus minor pilin ComGD	-
JC284_RS06020 (JC284_06020)	-	1283264..1283464 (+)	201	WP_020219623.1	hypothetical protein	-
JC284_RS06025 (JC284_06025)	-	1283370..1283855 (+)	486	WP_080552896.1	prepilin-type N-terminal cleavage/methylation domain-containing protein	-
JC284_RS06030 (JC284_06030)	-	1284019..1284546 (+)	528	WP_014613826.1	shikimate kinase	-
JC284_RS06035 (JC284_06035)	gcvT	1284704..1285795 (+)	1092	WP_015729161.1	glycine cleavage system aminomethyltransferase GcvT	-
JC284_RS06040 (JC284_06040)	gcvPA	1285808..1287157 (+)	1350	WP_101431444.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 107 a.a.
• Molecular weight: 12027.26 Da
• Isoelectric Point: 9.0966

>NTDB_id=515163 JC284_RS06010 WP_015729165.1 1282418..1282741(+) (comGC) [Staphylococcus pseudintermedius strain SP_11306-4A]
MIQQLKLKFNKKKGFTLIEMLLVLLIISVLLILIIPNIAKQSDHIQKTGCAAQLKMVDSQIEAYALKFNHKPNTIDDLVR
EGYIKESQKTCKSGEEITIRDGEAVAS

Nucleotide

• Length: 324 bp

>NTDB_id=515163 JC284_RS06010 WP_015729165.1 1282418..1282741(+) (comGC) [Staphylococcus pseudintermedius strain SP_11306-4A]
ATGATTCAACAACTTAAATTAAAATTCAACAAAAAGAAAGGTTTTACATTAATTGAAATGCTACTTGTTCTGTTAATTAT
TAGTGTACTATTGATTCTCATTATCCCGAATATTGCTAAGCAGTCAGATCATATCCAAAAAACGGGTTGTGCTGCACAAT
TAAAAATGGTCGATAGTCAAATAGAAGCCTATGCTTTAAAGTTTAACCACAAACCGAATACGATTGATGATTTAGTTCGT
GAAGGCTACATTAAAGAAAGTCAAAAAACATGCAAATCAGGTGAAGAGATCACAATCAGAGATGGCGAAGCAGTTGCGTC
ATGA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (10-34)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	73.529	95.327	0.701
comGC	Staphylococcus aureus N315	73.529	95.327	0.701
comGC/cglC	Streptococcus mitis SK321	44.898	91.589	0.411
comGC/cglC	Streptococcus pneumoniae D39	43.878	91.589	0.402
comGC/cglC	Streptococcus pneumoniae TIGR4	43.878	91.589	0.402
comGC/cglC	Streptococcus pneumoniae Rx1	43.878	91.589	0.402
comGC/cglC	Streptococcus pneumoniae R6	43.878	91.589	0.402
comYC	Streptococcus suis isolate S10	53.846	72.897	0.393
comYC	Streptococcus gordonii str. Challis substr. CH1	49.398	77.57	0.383
comGC	Bacillus subtilis subsp. subtilis str. 168	44.565	85.981	0.383
comGC/cglC	Streptococcus mitis NCTC 12261	48.78	76.636	0.374
comGC	Lactococcus lactis subsp. cremoris KW2	48.78	76.636	0.374