Detailed information NTG0051157

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: SIR_RS18225
• Genome accession: NC_022246
• Coordinates: 1759929..1760246 (-)
• Length: 105 a.a.
• NCBI ID: WP_003075998.1
• Uniprot ID: T1ZFK9
• Organism: Streptococcus intermedius B196
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1754929..1765246

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SIR_RS18195 (SIR_1661)	-	1756258..1757457 (-)	1200	WP_021003254.1	acetate kinase	-
SIR_RS18200 (SIR_1662)	comGH	1757504..1758457 (-)	954	WP_021003255.1	class I SAM-dependent methyltransferase	Machinery gene
SIR_RS18205 (SIR_1663)	comGG/cglG	1758548..1758874 (-)	327	WP_021003256.1	competence type IV pilus minor pilin ComGG	Machinery gene
SIR_RS18210 (SIR_1664)	comGF/cglF	1758855..1759292 (-)	438	WP_003073990.1	competence type IV pilus minor pilin ComGF	Machinery gene
SIR_RS18215 (SIR_1665)	comGE/cglE	1759276..1759569 (-)	294	WP_003073987.1	competence type IV pilus minor pilin ComGE	Machinery gene
SIR_RS18220 (SIR_1666)	comGD	1759541..1759969 (-)	429	WP_021003257.1	competence type IV pilus minor pilin ComGD	Machinery gene
SIR_RS18225 (SIR_1667)	comGC	1759929..1760246 (-)	318	WP_003075998.1	competence type IV pilus major pilin ComGC	Machinery gene
SIR_RS18230 (SIR_1668)	comGB	1760243..1761265 (-)	1023	WP_021003258.1	competence type IV pilus assembly protein ComGB	Machinery gene
SIR_RS18235 (SIR_1669)	comGA	1761207..1762148 (-)	942	WP_003073980.1	competence type IV pilus ATPase ComGA	Machinery gene
SIR_RS18240 (SIR_1670)	-	1762217..1762582 (-)	366	WP_021003259.1	DUF1033 family protein	-
SIR_RS18245 (SIR_1671)	glnA	1762804..1764150 (-)	1347	WP_021003260.1	type I glutamate--ammonia ligase	-
SIR_RS18250 (SIR_1672)	-	1764189..1764548 (-)	360	WP_003073972.1	MerR family transcriptional regulator	-
SIR_RS18255 (SIR_1673)	-	1764625..1765155 (-)	531	WP_009569519.1	FUSC family protein	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11666.77 Da
• Isoelectric Point: 10.1006

>NTDB_id=51157 SIR_RS18225 WP_003075998.1 1759929..1760246(-) (comGC) [Streptococcus intermedius B196]
MKKIKNLKVKAFTLVEMLVVLLIISVLMLLFVPNLTKQKEAVTEKGNAAVVKVVESQAELFEVNHSNEKATLSKLVTEGT
ITDKQAASYKAYYAKHTKETRSVAD

Nucleotide

• Length: 318 bp

>NTDB_id=51157 SIR_RS18225 WP_003075998.1 1759929..1760246(-) (comGC) [Streptococcus intermedius B196]
GTGAAAAAAATTAAAAATTTAAAGGTTAAAGCTTTTACTTTAGTGGAAATGTTGGTCGTGCTTTTAATTATTAGTGTTTT
AATGCTCTTATTTGTGCCGAATTTGACCAAGCAAAAGGAAGCAGTAACAGAAAAAGGAAATGCAGCTGTGGTCAAAGTTG
TAGAGAGCCAAGCGGAACTTTTTGAGGTCAATCATAGCAATGAAAAAGCAACGCTTTCAAAATTAGTCACTGAAGGCACG
ATTACAGATAAGCAGGCAGCGTCATATAAGGCTTACTATGCGAAACATACAAAAGAAACTCGTTCTGTTGCAGATTAA

Domains

Predicted by InterProScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-30)

3D structure

• AlphaFold DB: T1ZFK9

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Streptococcus gordonii str. Challis substr. CH1	73.333	100	0.733
comGC	Streptococcus mutans UA140	68.571	100	0.686
comGC	Streptococcus mutans UA159	68.571	100	0.686
comGC/cglC	Streptococcus mitis NCTC 12261	68.627	97.143	0.667
comGC/cglC	Streptococcus mitis SK321	68.627	97.143	0.667
comGC/cglC	Streptococcus pneumoniae Rx1	66.667	97.143	0.648
comGC/cglC	Streptococcus pneumoniae D39	66.667	97.143	0.648
comGC/cglC	Streptococcus pneumoniae TIGR4	66.667	97.143	0.648
comGC/cglC	Streptococcus pneumoniae R6	66.667	97.143	0.648
comGC	Lactococcus lactis subsp. cremoris KW2	54.808	99.048	0.543
comGC	Streptococcus suis isolate S10	64.045	84.762	0.543