Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | IUJ40_RS06350 | Genome accession | NZ_CP064389 |
| Coordinates | 1226237..1226548 (+) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain PartE-Saureus-RM8376 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1213645..1271047 | 1226237..1226548 | within | 0 |
Gene organization within MGE regions
Location: 1213645..1271047
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IUJ40_RS06280 (IUJ40_06290) | - | 1214396..1215181 (+) | 786 | WP_001213908.1 | metal ABC transporter ATP-binding protein | - |
| IUJ40_RS06285 (IUJ40_06295) | - | 1215223..1216086 (+) | 864 | WP_000564316.1 | metal ABC transporter permease | - |
| IUJ40_RS06290 (IUJ40_06300) | - | 1216073..1216483 (+) | 411 | WP_001095260.1 | Fur family transcriptional regulator | - |
| IUJ40_RS06295 (IUJ40_06305) | - | 1216759..1217358 (+) | 600 | WP_000863556.1 | superoxide dismutase | - |
| IUJ40_RS06300 (IUJ40_06310) | - | 1217479..1219554 (+) | 2076 | WP_000919772.1 | penicillin-binding protein 2 | - |
| IUJ40_RS06305 (IUJ40_06315) | rpmG | 1219667..1219816 (+) | 150 | WP_001265709.1 | 50S ribosomal protein L33 | - |
| IUJ40_RS06310 (IUJ40_06320) | - | 1220025..1220564 (+) | 540 | WP_000164545.1 | 5-formyltetrahydrofolate cyclo-ligase | - |
| IUJ40_RS06315 (IUJ40_06325) | - | 1220576..1222039 (+) | 1464 | WP_001017867.1 | rhomboid family intramembrane serine protease | - |
| IUJ40_RS06320 (IUJ40_06330) | - | 1222020..1222223 (+) | 204 | WP_000087561.1 | YqgQ family protein | - |
| IUJ40_RS06325 (IUJ40_06335) | - | 1222220..1223206 (+) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| IUJ40_RS06330 (IUJ40_06340) | - | 1223206..1223535 (+) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| IUJ40_RS06335 (IUJ40_06345) | - | 1223532..1224155 (+) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| IUJ40_RS06340 (IUJ40_06350) | comGA | 1224207..1225181 (+) | 975 | WP_000697228.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| IUJ40_RS06345 (IUJ40_06355) | comGB | 1225153..1226223 (+) | 1071 | WP_000775708.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| IUJ40_RS06350 (IUJ40_06360) | comGC | 1226237..1226548 (+) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| IUJ40_RS06355 (IUJ40_06365) | comGD | 1226526..1226972 (+) | 447 | WP_001790850.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| IUJ40_RS06360 (IUJ40_06370) | comGE | 1226959..1227258 (+) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| IUJ40_RS06365 (IUJ40_06375) | comGF | 1227176..1227673 (+) | 498 | WP_001789864.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| IUJ40_RS06370 (IUJ40_06380) | - | 1227770..1227916 (+) | 147 | WP_001789879.1 | hypothetical protein | - |
| IUJ40_RS06375 (IUJ40_06385) | - | 1227906..1228430 (+) | 525 | WP_001015117.1 | shikimate kinase | - |
| IUJ40_RS06380 (IUJ40_06390) | gcvT | 1228589..1229680 (+) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| IUJ40_RS06385 (IUJ40_06395) | gcvPA | 1229700..1231046 (+) | 1347 | WP_000019693.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| IUJ40_RS06390 (IUJ40_06400) | gcvPB | 1231039..1232511 (+) | 1473 | WP_000202192.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPB | - |
| IUJ40_RS06395 (IUJ40_06405) | - | 1232876..1233262 (-) | 387 | WP_001276571.1 | rhodanese-like domain-containing protein | - |
| IUJ40_RS06400 (IUJ40_06410) | - | 1233420..1234250 (+) | 831 | WP_000141109.1 | biotin/lipoate A/B protein ligase family protein | - |
| IUJ40_RS06405 (IUJ40_06415) | - | 1234314..1234532 (-) | 219 | WP_001244298.1 | SA1362 family protein | - |
| IUJ40_RS06410 (IUJ40_06420) | - | 1234546..1235127 (-) | 582 | WP_000737686.1 | hypothetical protein | - |
| IUJ40_RS06415 (IUJ40_06425) | - | 1235232..1236293 (+) | 1062 | WP_000087107.1 | Xaa-Pro peptidase family protein | - |
| IUJ40_RS06420 (IUJ40_06430) | efp | 1236319..1236876 (+) | 558 | WP_000626504.1 | elongation factor P | - |
| IUJ40_RS06425 (IUJ40_06435) | - | 1237271..1237555 (+) | 285 | WP_000134545.1 | hypothetical protein | - |
| IUJ40_RS06430 (IUJ40_06440) | - | 1237706..1238026 (+) | 321 | WP_000805733.1 | DUF961 family protein | - |
| IUJ40_RS06435 (IUJ40_06445) | - | 1238040..1238342 (+) | 303 | WP_000386891.1 | hypothetical protein | - |
| IUJ40_RS06440 (IUJ40_06450) | - | 1238517..1239608 (+) | 1092 | WP_000172943.1 | replication initiation factor domain-containing protein | - |
| IUJ40_RS06445 (IUJ40_06455) | - | 1239669..1240724 (+) | 1056 | WP_000692002.1 | conjugal transfer protein | - |
| IUJ40_RS06450 (IUJ40_06460) | - | 1240729..1240989 (+) | 261 | WP_000015639.1 | TcpD family membrane protein | - |
| IUJ40_RS06455 (IUJ40_06465) | - | 1241001..1241384 (+) | 384 | WP_000358144.1 | TcpE family conjugal transfer membrane protein | - |
| IUJ40_RS06460 (IUJ40_06470) | - | 1241419..1243914 (+) | 2496 | WP_001049264.1 | ATP-binding protein | - |
| IUJ40_RS06465 (IUJ40_06475) | - | 1243968..1245326 (+) | 1359 | WP_001251212.1 | FtsK/SpoIIIE domain-containing protein | - |
| IUJ40_RS06470 (IUJ40_06480) | - | 1245331..1247178 (+) | 1848 | WP_000681143.1 | CD3337/EF1877 family mobilome membrane protein | - |
| IUJ40_RS06475 (IUJ40_06485) | - | 1247168..1248214 (+) | 1047 | WP_000247469.1 | CHAP domain-containing protein | - |
| IUJ40_RS06480 (IUJ40_06490) | - | 1248221..1248811 (+) | 591 | WP_000810443.1 | hypothetical protein | - |
| IUJ40_RS06485 (IUJ40_06495) | - | 1248867..1249208 (+) | 342 | WP_001255377.1 | cystatin-like fold lipoprotein | - |
| IUJ40_RS06490 (IUJ40_06500) | - | 1249317..1249820 (+) | 504 | WP_000746371.1 | transposase | - |
| IUJ40_RS06495 (IUJ40_06505) | - | 1249849..1250337 (+) | 489 | WP_176318786.1 | IS30 family transposase | - |
| IUJ40_RS06500 (IUJ40_06510) | accB | 1250692..1251156 (+) | 465 | WP_001009516.1 | acetyl-CoA carboxylase biotin carboxyl carrier protein | - |
| IUJ40_RS06505 (IUJ40_06515) | accC | 1251156..1252511 (+) | 1356 | WP_000756612.1 | acetyl-CoA carboxylase biotin carboxylase subunit | - |
| IUJ40_RS06510 (IUJ40_06520) | - | 1252526..1252888 (+) | 363 | WP_000241588.1 | Asp23/Gls24 family envelope stress response protein | - |
| IUJ40_RS06515 (IUJ40_06525) | nusB | 1252948..1253337 (+) | 390 | WP_000087385.1 | transcription antitermination factor NusB | - |
| IUJ40_RS06520 (IUJ40_06530) | xseA | 1253354..1254691 (+) | 1338 | WP_001286928.1 | exodeoxyribonuclease VII large subunit | - |
| IUJ40_RS06525 (IUJ40_06535) | - | 1254684..1254914 (+) | 231 | WP_000159865.1 | exodeoxyribonuclease VII small subunit | - |
| IUJ40_RS06530 (IUJ40_06540) | - | 1254892..1255773 (+) | 882 | WP_000183378.1 | polyprenyl synthetase family protein | - |
| IUJ40_RS06535 (IUJ40_06545) | ahrC | 1256205..1256657 (+) | 453 | WP_001124985.1 | transcriptional regulator AhrC/ArgR | - |
| IUJ40_RS06540 (IUJ40_06550) | recN | 1256673..1258352 (+) | 1680 | WP_000942211.1 | DNA repair protein RecN | - |
| IUJ40_RS06545 (IUJ40_06555) | lpdA | 1258503..1259924 (+) | 1422 | WP_001291535.1 | dihydrolipoyl dehydrogenase | - |
| IUJ40_RS06550 (IUJ40_06560) | - | 1259940..1260932 (+) | 993 | WP_000568353.1 | thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha | - |
| IUJ40_RS06555 (IUJ40_06565) | - | 1260932..1261915 (+) | 984 | WP_001096642.1 | alpha-ketoacid dehydrogenase subunit beta | - |
| IUJ40_RS06560 (IUJ40_06570) | - | 1261928..1263202 (+) | 1275 | WP_000406839.1 | dihydrolipoamide acetyltransferase family protein | - |
| IUJ40_RS06565 (IUJ40_06575) | brxB | 1263553..1263990 (+) | 438 | WP_000367419.1 | bacilliredoxin BrxB | - |
| IUJ40_RS06570 (IUJ40_06580) | - | 1264004..1264984 (+) | 981 | WP_000916195.1 | aromatic acid exporter family protein | - |
| IUJ40_RS06575 (IUJ40_06585) | prli42 | 1265111..1265290 (-) | 180 | WP_001789875.1 | stressosome-associated protein Prli42 | - |
| IUJ40_RS06580 (IUJ40_06590) | - | 1265553..1266686 (+) | 1134 | WP_000606676.1 | tripeptidase T | - |
| IUJ40_RS06585 (IUJ40_06595) | gndA | 1266754..1268160 (+) | 1407 | WP_000193707.1 | NADP-dependent phosphogluconate dehydrogenase | - |
| IUJ40_RS06590 (IUJ40_06600) | - | 1268379..1268750 (+) | 372 | WP_000413437.1 | VOC family protein | - |
| IUJ40_RS06595 (IUJ40_06605) | - | 1268689..1268943 (+) | 255 | WP_001791638.1 | hypothetical protein | - |
| IUJ40_RS06600 (IUJ40_06610) | - | 1268944..1269963 (+) | 1020 | WP_000256338.1 | LacI family DNA-binding transcriptional regulator | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=501581 IUJ40_RS06350 WP_000472256.1 1226237..1226548(+) (comGC) [Staphylococcus aureus strain PartE-Saureus-RM8376]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=501581 IUJ40_RS06350 WP_000472256.1 1226237..1226548(+) (comGC) [Staphylococcus aureus strain PartE-Saureus-RM8376]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |