Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   IUJ40_RS06355 Genome accession   NZ_CP064389
Coordinates   1226526..1226972 (+) Length   148 a.a.
NCBI ID   WP_001790850.1    Uniprot ID   -
Organism   Staphylococcus aureus strain PartE-Saureus-RM8376     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1213645..1271047 1226526..1226972 within 0


Gene organization within MGE regions


Location: 1213645..1271047
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IUJ40_RS06280 (IUJ40_06290) - 1214396..1215181 (+) 786 WP_001213908.1 metal ABC transporter ATP-binding protein -
  IUJ40_RS06285 (IUJ40_06295) - 1215223..1216086 (+) 864 WP_000564316.1 metal ABC transporter permease -
  IUJ40_RS06290 (IUJ40_06300) - 1216073..1216483 (+) 411 WP_001095260.1 Fur family transcriptional regulator -
  IUJ40_RS06295 (IUJ40_06305) - 1216759..1217358 (+) 600 WP_000863556.1 superoxide dismutase -
  IUJ40_RS06300 (IUJ40_06310) - 1217479..1219554 (+) 2076 WP_000919772.1 penicillin-binding protein 2 -
  IUJ40_RS06305 (IUJ40_06315) rpmG 1219667..1219816 (+) 150 WP_001265709.1 50S ribosomal protein L33 -
  IUJ40_RS06310 (IUJ40_06320) - 1220025..1220564 (+) 540 WP_000164545.1 5-formyltetrahydrofolate cyclo-ligase -
  IUJ40_RS06315 (IUJ40_06325) - 1220576..1222039 (+) 1464 WP_001017867.1 rhomboid family intramembrane serine protease -
  IUJ40_RS06320 (IUJ40_06330) - 1222020..1222223 (+) 204 WP_000087561.1 YqgQ family protein -
  IUJ40_RS06325 (IUJ40_06335) - 1222220..1223206 (+) 987 WP_000161314.1 ROK family glucokinase -
  IUJ40_RS06330 (IUJ40_06340) - 1223206..1223535 (+) 330 WP_001018871.1 MTH1187 family thiamine-binding protein -
  IUJ40_RS06335 (IUJ40_06345) - 1223532..1224155 (+) 624 WP_001223008.1 MBL fold metallo-hydrolase -
  IUJ40_RS06340 (IUJ40_06350) comGA 1224207..1225181 (+) 975 WP_000697228.1 competence type IV pilus ATPase ComGA Machinery gene
  IUJ40_RS06345 (IUJ40_06355) comGB 1225153..1226223 (+) 1071 WP_000775708.1 competence type IV pilus assembly protein ComGB Machinery gene
  IUJ40_RS06350 (IUJ40_06360) comGC 1226237..1226548 (+) 312 WP_000472256.1 competence type IV pilus major pilin ComGC Machinery gene
  IUJ40_RS06355 (IUJ40_06365) comGD 1226526..1226972 (+) 447 WP_001790850.1 competence type IV pilus minor pilin ComGD Machinery gene
  IUJ40_RS06360 (IUJ40_06370) comGE 1226959..1227258 (+) 300 WP_000844413.1 hypothetical protein Machinery gene
  IUJ40_RS06365 (IUJ40_06375) comGF 1227176..1227673 (+) 498 WP_001789864.1 competence type IV pilus minor pilin ComGF Machinery gene
  IUJ40_RS06370 (IUJ40_06380) - 1227770..1227916 (+) 147 WP_001789879.1 hypothetical protein -
  IUJ40_RS06375 (IUJ40_06385) - 1227906..1228430 (+) 525 WP_001015117.1 shikimate kinase -
  IUJ40_RS06380 (IUJ40_06390) gcvT 1228589..1229680 (+) 1092 WP_000093349.1 glycine cleavage system aminomethyltransferase GcvT -
  IUJ40_RS06385 (IUJ40_06395) gcvPA 1229700..1231046 (+) 1347 WP_000019693.1 aminomethyl-transferring glycine dehydrogenase subunit GcvPA -
  IUJ40_RS06390 (IUJ40_06400) gcvPB 1231039..1232511 (+) 1473 WP_000202192.1 aminomethyl-transferring glycine dehydrogenase subunit GcvPB -
  IUJ40_RS06395 (IUJ40_06405) - 1232876..1233262 (-) 387 WP_001276571.1 rhodanese-like domain-containing protein -
  IUJ40_RS06400 (IUJ40_06410) - 1233420..1234250 (+) 831 WP_000141109.1 biotin/lipoate A/B protein ligase family protein -
  IUJ40_RS06405 (IUJ40_06415) - 1234314..1234532 (-) 219 WP_001244298.1 SA1362 family protein -
  IUJ40_RS06410 (IUJ40_06420) - 1234546..1235127 (-) 582 WP_000737686.1 hypothetical protein -
  IUJ40_RS06415 (IUJ40_06425) - 1235232..1236293 (+) 1062 WP_000087107.1 Xaa-Pro peptidase family protein -
  IUJ40_RS06420 (IUJ40_06430) efp 1236319..1236876 (+) 558 WP_000626504.1 elongation factor P -
  IUJ40_RS06425 (IUJ40_06435) - 1237271..1237555 (+) 285 WP_000134545.1 hypothetical protein -
  IUJ40_RS06430 (IUJ40_06440) - 1237706..1238026 (+) 321 WP_000805733.1 DUF961 family protein -
  IUJ40_RS06435 (IUJ40_06445) - 1238040..1238342 (+) 303 WP_000386891.1 hypothetical protein -
  IUJ40_RS06440 (IUJ40_06450) - 1238517..1239608 (+) 1092 WP_000172943.1 replication initiation factor domain-containing protein -
  IUJ40_RS06445 (IUJ40_06455) - 1239669..1240724 (+) 1056 WP_000692002.1 conjugal transfer protein -
  IUJ40_RS06450 (IUJ40_06460) - 1240729..1240989 (+) 261 WP_000015639.1 TcpD family membrane protein -
  IUJ40_RS06455 (IUJ40_06465) - 1241001..1241384 (+) 384 WP_000358144.1 TcpE family conjugal transfer membrane protein -
  IUJ40_RS06460 (IUJ40_06470) - 1241419..1243914 (+) 2496 WP_001049264.1 ATP-binding protein -
  IUJ40_RS06465 (IUJ40_06475) - 1243968..1245326 (+) 1359 WP_001251212.1 FtsK/SpoIIIE domain-containing protein -
  IUJ40_RS06470 (IUJ40_06480) - 1245331..1247178 (+) 1848 WP_000681143.1 CD3337/EF1877 family mobilome membrane protein -
  IUJ40_RS06475 (IUJ40_06485) - 1247168..1248214 (+) 1047 WP_000247469.1 CHAP domain-containing protein -
  IUJ40_RS06480 (IUJ40_06490) - 1248221..1248811 (+) 591 WP_000810443.1 hypothetical protein -
  IUJ40_RS06485 (IUJ40_06495) - 1248867..1249208 (+) 342 WP_001255377.1 cystatin-like fold lipoprotein -
  IUJ40_RS06490 (IUJ40_06500) - 1249317..1249820 (+) 504 WP_000746371.1 transposase -
  IUJ40_RS06495 (IUJ40_06505) - 1249849..1250337 (+) 489 WP_176318786.1 IS30 family transposase -
  IUJ40_RS06500 (IUJ40_06510) accB 1250692..1251156 (+) 465 WP_001009516.1 acetyl-CoA carboxylase biotin carboxyl carrier protein -
  IUJ40_RS06505 (IUJ40_06515) accC 1251156..1252511 (+) 1356 WP_000756612.1 acetyl-CoA carboxylase biotin carboxylase subunit -
  IUJ40_RS06510 (IUJ40_06520) - 1252526..1252888 (+) 363 WP_000241588.1 Asp23/Gls24 family envelope stress response protein -
  IUJ40_RS06515 (IUJ40_06525) nusB 1252948..1253337 (+) 390 WP_000087385.1 transcription antitermination factor NusB -
  IUJ40_RS06520 (IUJ40_06530) xseA 1253354..1254691 (+) 1338 WP_001286928.1 exodeoxyribonuclease VII large subunit -
  IUJ40_RS06525 (IUJ40_06535) - 1254684..1254914 (+) 231 WP_000159865.1 exodeoxyribonuclease VII small subunit -
  IUJ40_RS06530 (IUJ40_06540) - 1254892..1255773 (+) 882 WP_000183378.1 polyprenyl synthetase family protein -
  IUJ40_RS06535 (IUJ40_06545) ahrC 1256205..1256657 (+) 453 WP_001124985.1 transcriptional regulator AhrC/ArgR -
  IUJ40_RS06540 (IUJ40_06550) recN 1256673..1258352 (+) 1680 WP_000942211.1 DNA repair protein RecN -
  IUJ40_RS06545 (IUJ40_06555) lpdA 1258503..1259924 (+) 1422 WP_001291535.1 dihydrolipoyl dehydrogenase -
  IUJ40_RS06550 (IUJ40_06560) - 1259940..1260932 (+) 993 WP_000568353.1 thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha -
  IUJ40_RS06555 (IUJ40_06565) - 1260932..1261915 (+) 984 WP_001096642.1 alpha-ketoacid dehydrogenase subunit beta -
  IUJ40_RS06560 (IUJ40_06570) - 1261928..1263202 (+) 1275 WP_000406839.1 dihydrolipoamide acetyltransferase family protein -
  IUJ40_RS06565 (IUJ40_06575) brxB 1263553..1263990 (+) 438 WP_000367419.1 bacilliredoxin BrxB -
  IUJ40_RS06570 (IUJ40_06580) - 1264004..1264984 (+) 981 WP_000916195.1 aromatic acid exporter family protein -
  IUJ40_RS06575 (IUJ40_06585) prli42 1265111..1265290 (-) 180 WP_001789875.1 stressosome-associated protein Prli42 -
  IUJ40_RS06580 (IUJ40_06590) - 1265553..1266686 (+) 1134 WP_000606676.1 tripeptidase T -
  IUJ40_RS06585 (IUJ40_06595) gndA 1266754..1268160 (+) 1407 WP_000193707.1 NADP-dependent phosphogluconate dehydrogenase -
  IUJ40_RS06590 (IUJ40_06600) - 1268379..1268750 (+) 372 WP_000413437.1 VOC family protein -
  IUJ40_RS06595 (IUJ40_06605) - 1268689..1268943 (+) 255 WP_001791638.1 hypothetical protein -
  IUJ40_RS06600 (IUJ40_06610) - 1268944..1269963 (+) 1020 WP_000256338.1 LacI family DNA-binding transcriptional regulator -

Sequence


Protein


Download         Length: 148 a.a.        Molecular weight: 17213.42 Da        Isoelectric Point: 10.3682

>NTDB_id=501582 IUJ40_RS06355 WP_001790850.1 1226526..1226972(+) (comGD) [Staphylococcus aureus strain PartE-Saureus-RM8376]
MEKQLQIRKQSAFTMIEMLVVMMLISIFLLLTMTSKGLSNLRVIDDEANIISFITELNYIKSQAIANQGYINVRFYENSD
TIKVIENNKIRFLKLKVGKIINVAKVDIIAFDKKGNINKFGSITIYNNNSIYRIIFHIEKGRIRYEKL

Nucleotide


Download         Length: 447 bp        

>NTDB_id=501582 IUJ40_RS06355 WP_001790850.1 1226526..1226972(+) (comGD) [Staphylococcus aureus strain PartE-Saureus-RM8376]
ATGGAGAAGCAGTTGCAAATTAGAAAGCAGTCAGCATTTACTATGATTGAGATGCTTGTGGTAATGATGTTAATCAGTAT
ATTTCTACTTTTGACAATGACATCTAAAGGATTAAGCAATCTTAGAGTAATAGATGATGAGGCAAATATCATTTCTTTTA
TTACTGAATTGAATTATATTAAGTCGCAAGCTATAGCAAATCAAGGATATATCAATGTTAGATTTTATGAAAACAGTGAC
ACTATTAAAGTAATAGAGAATAATAAAATACGATTTCTAAAATTAAAAGTAGGCAAAATAATTAATGTTGCAAAAGTTGA
TATTATTGCCTTTGATAAAAAAGGGAATATCAATAAATTTGGTAGCATAACAATTTACAATAACAATTCAATTTATAGAA
TAATATTCCATATTGAAAAAGGAAGAATTCGTTATGAAAAGCTATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Staphylococcus aureus MW2

99.324

100

0.993

  comGD Staphylococcus aureus N315

99.324

100

0.993