Detailed information NTG0493307

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: IMZ86_RS06625
• Genome accession: NZ_CP063143
• Coordinates: 1389713..1390027 (+)
• Length: 104 a.a.
• NCBI ID: WP_002459016.1
• Uniprot ID: -
• Organism: Staphylococcus lugdunensis strain IVK28
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1384713..1395027

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
IMZ86_RS06595 (IMZ86_06595)	-	1385505..1385708 (+)	204	WP_002459010.1	YqgQ family protein	-
IMZ86_RS06600 (IMZ86_06600)	-	1385705..1386691 (+)	987	WP_002491907.1	ROK family glucokinase	-
IMZ86_RS06605 (IMZ86_06605)	-	1386691..1387014 (+)	324	WP_002459012.1	MTH1187 family thiamine-binding protein	-
IMZ86_RS06610 (IMZ86_06610)	-	1387018..1387641 (+)	624	WP_002459013.1	MBL fold metallo-hydrolase	-
IMZ86_RS06615 (IMZ86_06615)	comGA	1387688..1388662 (+)	975	WP_037555185.1	competence type IV pilus ATPase ComGA	Machinery gene
IMZ86_RS06620 (IMZ86_06620)	comGB	1388634..1389698 (+)	1065	WP_002478130.1	competence type IV pilus assembly protein ComGB	-
IMZ86_RS06625 (IMZ86_06625)	comGC	1389713..1390027 (+)	315	WP_002459016.1	competence type IV pilus major pilin ComGC	Machinery gene
IMZ86_RS06630 (IMZ86_06630)	comGD	1389960..1390454 (+)	495	WP_225306455.1	competence type IV pilus minor pilin ComGD	-
IMZ86_RS06635 (IMZ86_06635)	-	1390441..1390734 (+)	294	WP_002459018.1	hypothetical protein	-
IMZ86_RS06640 (IMZ86_06640)	-	1390796..1391155 (+)	360	WP_002459019.1	competence type IV pilus minor pilin ComGF	-
IMZ86_RS06645 (IMZ86_06645)	-	1391309..1391827 (+)	519	WP_002459021.1	shikimate kinase	-
IMZ86_RS06650 (IMZ86_06650)	gcvT	1391997..1393088 (+)	1092	WP_037540763.1	glycine cleavage system aminomethyltransferase GcvT	-
IMZ86_RS06655 (IMZ86_06655)	gcvPA	1393105..1394454 (+)	1350	WP_002478134.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 104 a.a.
• Molecular weight: 11373.37 Da
• Isoelectric Point: 8.2727

>NTDB_id=493307 IMZ86_RS06625 WP_002459016.1 1389713..1390027(+) (comGC) [Staphylococcus lugdunensis strain IVK28]
MKFSFYKKCKAFTLIEMLLVLLIISVLLILIIPNIAKQTAHVQSTGCEAQVKMVNSQIEAYTLKHNGSPKSIDDLISEGF
IKDGQKNCKSGETISISNGEAVAN

Nucleotide

• Length: 315 bp

>NTDB_id=493307 IMZ86_RS06625 WP_002459016.1 1389713..1390027(+) (comGC) [Staphylococcus lugdunensis strain IVK28]
ATGAAATTTTCTTTTTATAAAAAATGCAAAGCGTTTACACTAATAGAAATGTTATTAGTATTACTAATTATTAGTGTCTT
GCTTATCTTAATTATTCCAAACATTGCCAAACAAACAGCACATGTACAATCAACAGGTTGTGAAGCACAAGTAAAGATGG
TCAATAGCCAAATAGAAGCCTATACTCTAAAGCATAATGGATCTCCAAAAAGCATTGATGATTTAATTTCTGAGGGTTTT
ATTAAAGATGGTCAAAAGAATTGCAAATCTGGGGAAACCATCAGCATATCAAATGGTGAGGCAGTTGCAAATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (7-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	82.353	98.077	0.808
comGC	Staphylococcus aureus N315	82.353	98.077	0.808
comYC	Streptococcus gordonii str. Challis substr. CH1	45.918	94.231	0.433
comGC/cglC	Streptococcus pneumoniae TIGR4	44.554	97.115	0.433
comGC	Bacillus subtilis subsp. subtilis str. 168	46.154	87.5	0.404
comGC/cglC	Streptococcus pneumoniae R6	48.235	81.731	0.394
comGC/cglC	Streptococcus pneumoniae Rx1	48.235	81.731	0.394
comGC/cglC	Streptococcus pneumoniae D39	48.235	81.731	0.394
comGC	Lactococcus lactis subsp. cremoris KW2	50.633	75.962	0.385
comGC/cglC	Streptococcus mitis SK321	51.282	75	0.385
comGC/cglC	Streptococcus mitis NCTC 12261	51.282	75	0.385
comYC	Streptococcus mutans UA140	48.75	76.923	0.375
comYC	Streptococcus mutans UA159	48.75	76.923	0.375