Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | ILP77_RS00210 | Genome accession | NZ_CP062467 |
| Coordinates | 28004..28429 (-) | Length | 141 a.a. |
| NCBI ID | WP_000934780.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain MRSA - AMRF 5 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 199..36267 | 28004..28429 | within | 0 |
Gene organization within MGE regions
Location: 199..36267
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ILP77_RS00010 (ILP77_00010) | - | 199..2022 (-) | 1824 | WP_194085780.1 | phage baseplate upper protein | - |
| ILP77_RS00015 (ILP77_00015) | - | 2022..3933 (-) | 1912 | Protein_2 | hypothetical protein | - |
| ILP77_RS00020 (ILP77_00020) | - | 3948..5849 (-) | 1902 | WP_194085767.1 | SGNH/GDSL hydrolase family protein | - |
| ILP77_RS00025 (ILP77_00025) | - | 5858..6804 (-) | 947 | Protein_4 | phage tail family protein | - |
| ILP77_RS00030 (ILP77_00030) | - | 6817..10149 (-) | 3333 | WP_194085768.1 | phage tail protein | - |
| ILP77_RS00035 (ILP77_00035) | - | 10166..10510 (-) | 345 | WP_000105584.1 | hypothetical protein | - |
| ILP77_RS00040 (ILP77_00040) | - | 10540..10905 (-) | 366 | WP_001100161.1 | tail assembly chaperone | - |
| ILP77_RS00045 (ILP77_00045) | - | 10968..11546 (-) | 579 | Protein_8 | phage major tail protein, TP901-1 family | - |
| ILP77_RS00050 (ILP77_00050) | - | 11565..11948 (-) | 384 | WP_000188652.1 | hypothetical protein | - |
| ILP77_RS00055 (ILP77_00055) | - | 11960..12305 (-) | 346 | Protein_10 | HK97-gp10 family putative phage morphogenesis protein | - |
| ILP77_RS00060 (ILP77_00060) | - | 12305..12607 (-) | 303 | WP_176325151.1 | hypothetical protein | - |
| ILP77_RS00065 (ILP77_00065) | - | 12604..12936 (-) | 333 | WP_000208960.1 | phage head-tail connector protein | - |
| ILP77_RS00070 (ILP77_00070) | - | 12945..13232 (-) | 288 | WP_061821932.1 | hypothetical protein | - |
| ILP77_RS00075 (ILP77_00075) | - | 13254..14225 (-) | 972 | Protein_14 | phage major capsid protein | - |
| ILP77_RS00080 (ILP77_00080) | - | 14239..14654 (-) | 416 | Protein_15 | DUF4355 domain-containing protein | - |
| ILP77_RS14970 | - | 14663..14851 (-) | 189 | WP_416222487.1 | hypothetical protein | - |
| ILP77_RS00085 (ILP77_00085) | - | 14986..15156 (-) | 171 | WP_000072207.1 | hypothetical protein | - |
| ILP77_RS00090 (ILP77_00090) | - | 15229..16224 (-) | 996 | Protein_18 | minor capsid protein | - |
| ILP77_RS00095 (ILP77_00095) | - | 16231..17766 (-) | 1536 | WP_017804566.1 | phage portal protein | - |
| ILP77_RS00100 (ILP77_00100) | - | 17777..19054 (-) | 1278 | WP_000169945.1 | PBSX family phage terminase large subunit | - |
| ILP77_RS00105 (ILP77_00105) | - | 19041..19481 (-) | 441 | WP_001566315.1 | terminase small subunit | - |
| ILP77_RS00110 (ILP77_00110) | - | 19668..20090 (-) | 423 | WP_000162696.1 | RinA family phage transcriptional activator | - |
| ILP77_RS00115 (ILP77_00115) | - | 20114..20260 (-) | 147 | WP_000990005.1 | hypothetical protein | - |
| ILP77_RS00120 (ILP77_00120) | rinB | 20261..20434 (-) | 174 | WP_000595257.1 | transcriptional activator RinB | - |
| ILP77_RS00125 (ILP77_00125) | - | 20431..20817 (-) | 387 | WP_000592207.1 | hypothetical protein | - |
| ILP77_RS00130 (ILP77_00130) | - | 20814..21020 (-) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| ILP77_RS00135 (ILP77_00135) | - | 21279..21563 (-) | 285 | WP_000154474.1 | hypothetical protein | - |
| ILP77_RS00140 (ILP77_00140) | - | 21600..22109 (-) | 510 | WP_017804563.1 | dUTPase | - |
| ILP77_RS00145 (ILP77_00145) | - | 22102..22350 (-) | 249 | WP_001065083.1 | DUF1024 family protein | - |
| ILP77_RS00150 (ILP77_00150) | - | 22343..22570 (-) | 228 | Protein_30 | hypothetical protein | - |
| ILP77_RS14910 (ILP77_00155) | - | 22641..23067 (-) | 427 | Protein_31 | YopX family protein | - |
| ILP77_RS00160 (ILP77_00160) | - | 23132..23375 (-) | 244 | Protein_32 | SAV1978 family virulence-associated passenger protein | - |
| ILP77_RS00165 (ILP77_00165) | - | 23379..23739 (-) | 361 | Protein_33 | SA1788 family PVL leukocidin-associated protein | - |
| ILP77_RS00170 (ILP77_00170) | - | 23740..23925 (-) | 186 | WP_046472855.1 | DUF3113 family protein | - |
| ILP77_RS00175 (ILP77_00175) | - | 23930..24334 (-) | 405 | WP_194085781.1 | DUF1064 domain-containing protein | - |
| ILP77_RS00180 (ILP77_00180) | - | 24344..24565 (-) | 222 | WP_001123695.1 | DUF3269 family protein | - |
| ILP77_RS00185 (ILP77_00185) | - | 24578..24736 (-) | 159 | WP_000256594.1 | hypothetical protein | - |
| ILP77_RS00190 (ILP77_00190) | - | 24730..25508 (-) | 779 | Protein_38 | ATP-binding protein | - |
| ILP77_RS00195 (ILP77_00195) | - | 25518..26288 (-) | 771 | WP_000190224.1 | conserved phage C-terminal domain-containing protein | - |
| ILP77_RS00200 (ILP77_00200) | - | 26353..27210 (+) | 858 | WP_000371250.1 | DUF4393 domain-containing protein | - |
| ILP77_RS00205 (ILP77_00205) | - | 27316..27990 (-) | 675 | WP_194085782.1 | putative HNHc nuclease | - |
| ILP77_RS00210 (ILP77_00210) | ssbA | 28004..28429 (-) | 426 | WP_000934780.1 | single-stranded DNA-binding protein | Machinery gene |
| ILP77_RS00215 (ILP77_00215) | - | 28429..29052 (-) | 624 | WP_000139724.1 | DUF1071 domain-containing protein | - |
| ILP77_RS00220 (ILP77_00220) | - | 29045..29266 (-) | 222 | WP_000815401.1 | DUF2483 family protein | - |
| ILP77_RS00225 (ILP77_00225) | - | 29276..29536 (-) | 261 | WP_048657592.1 | DUF1108 family protein | - |
| ILP77_RS00230 (ILP77_00230) | - | 29628..29789 (-) | 162 | WP_000066019.1 | DUF1270 family protein | - |
| ILP77_RS00235 (ILP77_00235) | - | 29782..30003 (-) | 222 | WP_000977381.1 | hypothetical protein | - |
| ILP77_RS00240 (ILP77_00240) | - | 30017..30466 (-) | 450 | WP_000993183.1 | hypothetical protein | - |
| ILP77_RS00245 (ILP77_00245) | tscA | 30506..30730 (-) | 225 | WP_023604832.1 | type II toxin-antitoxin system antitoxin TscA | - |
| ILP77_RS00250 (ILP77_00250) | - | 30731..31522 (-) | 792 | WP_001148578.1 | phage antirepressor | - |
| ILP77_RS00255 (ILP77_00255) | - | 31538..31792 (-) | 255 | WP_001106628.1 | helix-turn-helix domain-containing protein | - |
| ILP77_RS00260 (ILP77_00260) | - | 31983..32621 (+) | 639 | WP_000874711.1 | XRE family transcriptional regulator | - |
| ILP77_RS00265 (ILP77_00265) | - | 32672..33172 (+) | 501 | WP_000896616.1 | hypothetical protein | - |
| ILP77_RS00270 (ILP77_00270) | - | 33176..33691 (+) | 516 | WP_000826266.1 | hypothetical protein | - |
| ILP77_RS00275 (ILP77_00275) | - | 33753..34802 (+) | 1050 | WP_001145728.1 | tyrosine-type recombinase/integrase | - |
| ILP77_RS00280 (ILP77_00280) | sufB | 34870..36267 (-) | 1398 | WP_001074405.1 | Fe-S cluster assembly protein SufB | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15847.32 Da Isoelectric Point: 4.6952
>NTDB_id=490223 ILP77_RS00210 WP_000934780.1 28004..28429(-) (ssbA) [Staphylococcus aureus strain MRSA - AMRF 5]
MLNRTVLVGRLTKDPEYRTAPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKVGQRVFVTEVVADSVQFLEPKNSNQQQNDNYQQQGQAQTGNNPFDNTEEDFSDLPF
MLNRTVLVGRLTKDPEYRTAPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKVGQRVFVTEVVADSVQFLEPKNSNQQQNDNYQQQGQAQTGNNPFDNTEEDFSDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=490223 ILP77_RS00210 WP_000934780.1 28004..28429(-) (ssbA) [Staphylococcus aureus strain MRSA - AMRF 5]
ATGTTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAGCGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGTCGGGCAACGTGTGTTTGTTACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAGCAACCAACAACAAAATGACAATTATCAACAACAAGGACAAGCTCAAACTGGTAATAATCCGTTTGACAATACTGAAG
AAGATTTTTCAGACCTCCCGTTCTGA
ATGTTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAGCGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGTCGGGCAACGTGTGTTTGTTACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAGCAACCAACAACAAAATGACAATTATCAACAACAAGGACAAGCTCAAACTGGTAATAATCCGTTTGACAATACTGAAG
AAGATTTTTCAGACCTCCCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
80.374 |
75.887 |
0.61 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
52.632 |
100 |
0.567 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
57.547 |
75.177 |
0.433 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
44.068 |
83.688 |
0.369 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
44.068 |
83.688 |
0.369 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
45.217 |
81.56 |
0.369 |
| ssbA | Streptococcus mutans UA159 |
44.348 |
81.56 |
0.362 |
| ssbB/cilA | Streptococcus mitis SK321 |
43.22 |
83.688 |
0.362 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
43.22 |
83.688 |
0.362 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
43.22 |
83.688 |
0.362 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
43.22 |
83.688 |
0.362 |